Align lysine decarboxylase (EC 4.1.1.18) (characterized)
to candidate Ac3H11_2594 FIG01199081: hypothetical protein
Query= BRENDA::A0A2Z4EVE5 (218 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2594 Length = 287 Score = 58.2 bits (139), Expect = 2e-13 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 8/121 (6%) Query: 51 GGSIGLMGLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQ---RKAEMAR 107 GG G+M ++ HD G +G+ +P E +G H RK Sbjct: 145 GGGPGIMEAANRGAHDEGALNVGL--NIALPHEQSGNRYITPSLSFKFHYFALRKMHFMM 202 Query: 108 HSDAFIALPGGYGTLEELLEVITWAQLG-IHDKPVGLLNVDGYYNSLLSFIDKAVEEGFI 166 + A +A PGG+GTL+EL EV+T Q G P+ L D Y+ L++F D VEEG I Sbjct: 203 RAKALVAFPGGFGTLDELFEVLTLVQTGKAKPVPIVLCGTD-YWKRLINF-DVLVEEGTI 260 Query: 167 S 167 S Sbjct: 261 S 261 Lambda K H 0.316 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 287 Length adjustment: 24 Effective length of query: 194 Effective length of database: 263 Effective search space: 51022 Effective search space used: 51022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory