Align Butyrate--acetoacetate CoA-transferase subunit A; Short=Coat A; EC 2.8.3.9 (characterized, see rationale)
to candidate Ac3H11_3922 3-oxoadipate CoA-transferase subunit A (EC 2.8.3.6)
Query= uniprot:P33752 (218 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3922 Length = 233 Score = 147 bits (371), Expect = 2e-40 Identities = 80/205 (39%), Positives = 118/205 (57%), Gaps = 8/205 (3%) Query: 16 KDGMTIMIGGFLNCGTPTKLIDFLVNLNIKNLTIISNDTCYPNTGIGKLISNNQVKKLIA 75 KDG T++IGGF G P +LID L+ ++LT+++N+ + G+ L+ QV+K+I Sbjct: 17 KDGATVLIGGFGTAGIPGELIDGLIAQGARDLTVVNNNAGNADQGLAALLKAGQVRKIIC 76 Query: 76 SYIGSNPDTGKKLFNN-----ELEVELSPQGTLVERIRAGGSGLGGVLTKTGLGTLIEKG 130 S+ +F++ +LE+EL PQG L ER+RA G+G+G T GT + G Sbjct: 77 SF---PRQVDSYVFDDLYRSGKLELELVPQGNLAERLRAAGAGIGAFFCPTAHGTELAAG 133 Query: 131 KKKISINGTEYLLELPLTADVALIKGSIVDEAGNTFYKGTTKNFNPYMAMAAKTVIVEAE 190 K+ ING Y+LE P+ DVALIK D GN Y+ + +NF P MA AAKT I Sbjct: 134 KETREINGKHYVLEYPIHGDVALIKAEKGDRWGNLTYRMSARNFGPVMATAAKTTIATVH 193 Query: 191 NLVSCEKLEKEKAMTPGVLINYIVK 215 +V L+ E +TPG+ + ++VK Sbjct: 194 EVVELGALDPEAIVTPGIYVTHVVK 218 Lambda K H 0.315 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 233 Length adjustment: 22 Effective length of query: 196 Effective length of database: 211 Effective search space: 41356 Effective search space used: 41356 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory