GapMind for catabolism of small carbon sources

 

Aligments for a candidate for davD in Acidovorax sp. GW101-3H11

Align Glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate Ac3H11_4184 Aldehyde dehydrogenase B (EC 1.2.1.22)

Query= reanno::pseudo13_GW456_L13:PfGW456L13_495
         (480 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4184 Aldehyde
           dehydrogenase B (EC 1.2.1.22)
          Length = 498

 Score =  578 bits (1490), Expect = e-169
 Identities = 285/484 (58%), Positives = 356/484 (73%), Gaps = 9/484 (1%)

Query: 3   LKDTQLFRQQAFIDGAWVDADNGQTIKVNNPATGEILGTVPKMGAAETRRAIEAADKALP 62
           L D  L +    I+G WV   +     VN+PATG  L  V  +G A+   AI AA+ A  
Sbjct: 11  LNDPTLLKTDGLINGQWVVGSS--RFDVNDPATGLKLADVANLGPADAEAAIAAANAAWG 68

Query: 63  AWRALTAKERATKLRRWYELIIENQDDLARLMTLEQGKPLAEAKGEIVYAASFIEWFAEE 122
            W+  TAKER+  LR+W++L++ NQDDL R+MT EQGKPLAEAKGE+ Y ASF+EWFAEE
Sbjct: 69  PWKTKTAKERSIILRKWFDLLMANQDDLGRIMTAEQGKPLAEAKGEVAYGASFVEWFAEE 128

Query: 123 AKRIYGDVIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPA 182
           AKRI G+ +P    ++RL+V+KQPIGV AAITPWNFP AMITRK  PALAAGC +V+KPA
Sbjct: 129 AKRINGETLPQFDNNRRLMVLKQPIGVCAAITPWNFPLAMITRKVAPALAAGCPVVIKPA 188

Query: 183 SQTPFSAFALAELAQRAGIPAGVFSVVSGSAGD---IGSELTSNPIVRKLSFTGSTEIGR 239
             TP +A A AELA RAGIPAGVF+++   + +   IG  L ++ +VR +SFTGSTE+GR
Sbjct: 189 ELTPLTALAAAELAIRAGIPAGVFNILPADSDNSIAIGKVLCASDVVRHISFTGSTEVGR 248

Query: 240 QLMSECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRLYIQD 299
            LM++ A  +KK+SLELGGNAPFIVFDDAD+D AVEGA  SKYRN GQTCVC NR Y+Q+
Sbjct: 249 ILMAQSAPTVKKMSLELGGNAPFIVFDDADIDSAVEGAFASKYRNAGQTCVCTNRFYVQE 308

Query: 300 GVYDAFAEKLKVAVAKLKIGNGLEAGTTTGPLIDEKAVAKVQEHIADALSKGATVLAGGK 359
           GVYD F  K    V   K+GNG EAG   GPLI+E A+ KVQ H+ DAL+KG  V+AGG+
Sbjct: 309 GVYDEFVAKFAAKVKTAKVGNGFEAGVNQGPLIEEAALTKVQRHVDDALAKGGQVVAGGQ 368

Query: 360 PM----EGNFFEPTILTNVPNNAAVAKEETFGPLAPLFRFKDEADVIAMSNDTEFGLASY 415
            +     G FFEPT++ N   +   A+EETFGP AP+F+FK E + I  +N+TEFGLASY
Sbjct: 369 RLTALGSGQFFEPTVVANATADMLCAREETFGPFAPVFKFKTEQEAIDAANNTEFGLASY 428

Query: 416 FYARDLGRVFRVAEALEYGMVGVNTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIKY 475
           FY+RD+GR+FRV EALEYGMVG N G+++ E  PFGG+K SGLGREGS +G++DY+EIKY
Sbjct: 429 FYSRDVGRIFRVTEALEYGMVGANVGILATEHVPFGGVKQSGLGREGSHHGMDDYVEIKY 488

Query: 476 LCLG 479
           LCLG
Sbjct: 489 LCLG 492


Lambda     K      H
   0.317    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 708
Number of extensions: 18
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 480
Length of database: 498
Length adjustment: 34
Effective length of query: 446
Effective length of database: 464
Effective search space:   206944
Effective search space used:   206944
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory