Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate Ac3H11_2553 Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2553 Length = 265 Score = 255 bits (651), Expect = 8e-73 Identities = 136/261 (52%), Positives = 176/261 (67%), Gaps = 10/261 (3%) Query: 4 PLSLATLAPEPDPRPVLIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLI 63 P++ A A EP ++RI GL K +G+ VL ID V + +V+ GPSGSGKST + Sbjct: 7 PMNGAGQAAEP-----IVRIRGLRKAFGSHVVLNGIDFDVLPSQVVVVIGPSGSGKSTFL 61 Query: 64 RCINRLEVAQQGSIQVDGIDLAATTR-----EAAQVRSDIGMVFQHFNLFPHMSVLDNCL 118 RC N LE + GS+++ G L R + +R ++GMVFQ FNLFPH+SVLDN Sbjct: 62 RCCNGLEQPEGGSVEICGRTLVQDGRMLPDHDLNALREEVGMVFQSFNLFPHLSVLDNVT 121 Query: 119 LAPTSVRGLSRKDAEERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIML 178 L P +RGLSRK+AEERA+ L+KVG+ +A P+ LSGGQ+QRVAIARAL M+PR+ML Sbjct: 122 LGPRKLRGLSRKEAEERAQALLTKVGLAHKAPAMPASLSGGQKQRVAIARALAMEPRVML 181 Query: 179 FDEPTSALDPEMVAEVLDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSP 238 FDEPTSALDPE+V EVL V+ LA GMTM+ VTHEM FAR+V + V+ ++GG IIE Sbjct: 182 FDEPTSALDPELVGEVLQVMKLLASEGMTMMVVTHEMDFAREVGDVVVVMDGGGIIEAGA 241 Query: 239 PQVFFNQPRTERAKAFLAQIL 259 P F P ER ++FL +L Sbjct: 242 PATIFTNPTQERTRSFLQAVL 262 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 265 Length adjustment: 25 Effective length of query: 235 Effective length of database: 240 Effective search space: 56400 Effective search space used: 56400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory