Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate Ac3H11_3200 Amino acid ABC transporter permease protein
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3200 Length = 604 Score = 254 bits (649), Expect = 3e-72 Identities = 132/250 (52%), Positives = 177/250 (70%), Gaps = 12/250 (4%) Query: 21 IRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQVD 80 + I G++K YGA VL+D+ L V G V+ GPSGSGKSTL+R IN LE G I +D Sbjct: 356 VTIHGVSKRYGALEVLKDVTLTVLPGSVTVILGPSGSGKSTLLRSINHLERVDGGFIAID 415 Query: 81 GIDLAATTREAAQV-----------RSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSR 129 G +L ++A + R D+GMVFQ+FNLFPH++VL+N + AP +VR L+R Sbjct: 416 G-ELIGYRQDADALYELGENDILKRRVDVGMVFQNFNLFPHLTVLENIVEAPVTVRKLAR 474 Query: 130 KDAEERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPE 189 +AE A L++VG+ +AH YP QLSGGQQQRVAIARAL +KP+++LFDEPTSALDPE Sbjct: 475 AEAEALALELLARVGLSDKAHSYPRQLSGGQQQRVAIARALALKPKVLLFDEPTSALDPE 534 Query: 190 MVAEVLDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRTE 249 +V EVLDV+ +LA TG T++ VTHE+GFAR+VA+ V+F+E G+++E P F+QP Sbjct: 535 LVGEVLDVIKELARTGTTLVIVTHEIGFAREVADTVVFMEQGRVVETGTPAKVFSQPDHP 594 Query: 250 RAKAFLAQIL 259 R AFLA++L Sbjct: 595 RTAAFLAKVL 604 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 604 Length adjustment: 31 Effective length of query: 229 Effective length of database: 573 Effective search space: 131217 Effective search space used: 131217 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory