Align ABC transporter for L-Lysine, ATPase component (characterized)
to candidate Ac3H11_4899 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_05515 (254 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4899 Length = 264 Score = 245 bits (625), Expect = 8e-70 Identities = 130/245 (53%), Positives = 179/245 (73%), Gaps = 10/245 (4%) Query: 6 IEGLHKSYGEHEVLKGVSLKAKTGDVISLIGASGSGKSTFLRCINFLEQPNDGAMTLDGQ 65 I L KSYG +EVLKG+ LK + G+VI++IG SGSGKST LRC+N LE+ +GA++++G+ Sbjct: 26 ITALRKSYGSNEVLKGIDLKVQRGEVIAIIGKSGSGKSTLLRCVNGLEEFQEGALSVNGK 85 Query: 66 PVQMIKDRHGMHVADADELQRIRTRLAMVFQHFNLWSHMTVLENITMAPRRVLGVSKQEA 125 K H A ++ +R ++ M+FQ FNL+ H++V NI +AP V + A Sbjct: 86 -----KLLHDSPTA----MRELRQQVGMIFQSFNLFPHLSVGRNIMLAPTLVKARDAKTA 136 Query: 126 DDRARRYLDKVGLPARVAEQYPAFLSGGQQQRVAIARALAMEPEVMLFDEPTSALDPELV 185 + +AR+ L++VGL A + P LSGGQQQRVAIARALAMEP+V+L DE TSALDPELV Sbjct: 137 ETQARKLLERVGL-AEKFDAMPDQLSGGQQQRVAIARALAMEPQVLLCDEITSALDPELV 195 Query: 186 GEVLKVIQGLAEEGRTMIMVTHEMSFARKVSNQVLFLHQGLVEEEGAPEDVLGNPKSERL 245 GEVL+V++ LA+EG T++MVTHEM+FARKV ++V+F+HQG V E+G P + GNP++ L Sbjct: 196 GEVLRVVESLAQEGMTLMMVTHEMAFARKVGDRVIFMHQGRVHEQGTPAALFGNPQTPEL 255 Query: 246 KQFLS 250 +QFLS Sbjct: 256 QQFLS 260 Lambda K H 0.319 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 264 Length adjustment: 24 Effective length of query: 230 Effective length of database: 240 Effective search space: 55200 Effective search space used: 55200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory