Align 3-keto-5-aminohexanoate cleavage enzyme (EC 2.3.1.247) (characterized)
to candidate Ac3H11_1929 FIG00537796: hypothetical protein
Query= BRENDA::Q8RHX2 (272 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1929 Length = 303 Score = 148 bits (374), Expect = 1e-40 Identities = 97/288 (33%), Positives = 151/288 (52%), Gaps = 23/288 (7%) Query: 4 KLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVREDDG----TPTQ 59 K IIT AI G +T VP T E++A+EA A AGA+++H+H R + P+ Sbjct: 10 KAIITCAITGV-LTDPGQHHVPVTPEQLAKEARGACDAGAAVVHVHFRNQEPGKGHLPSW 68 Query: 60 DKERFRKCIEAIREKCPDVIIQPSTG--GAVGMTDLERLQPTELHPEMATLDCGTCNF-- 115 D + R C++A+RE CP +II +TG G L+ L+ T PEMA + G+ N+ Sbjct: 69 DPQVARDCVQAMREACPGLIINQTTGVVGPHYQGPLDCLRATR--PEMAACNAGSLNYLK 126 Query: 116 --------GGDEIFVNTENTIKNFGKILIERGVKPEIEVFDKGMIDYAIRYQKQG-FIQK 166 +F N +K+F +++E G PE E FD G++ Y + G + ++ Sbjct: 127 VRSNGTWAWPPMLFDNQPAKVKDFIDVMLETGTLPEFECFDVGIVRCVEMYVQTGMYTER 186 Query: 167 PMHFDFVLGVQ--MSASARDLVFMSESIPEGSTWTVAGVGRHQFQMAALAIV-MGGHVRV 223 ++FV+GV+ M A L + + +G+ W +GR + + +GGH+R Sbjct: 187 LPEYNFVMGVESGMPADPDLLPILLKLKIKGAPWQATVIGRSEIWPVHQRVAELGGHLRT 246 Query: 224 GFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSLK 271 G ED Y+ G A SNG L+E++ A+ GRE+A+P EAR +L LK Sbjct: 247 GLEDTFYLPDGTKADSNGPLIEKLAEYARNAGREVASPQEARGMLGLK 294 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 303 Length adjustment: 26 Effective length of query: 246 Effective length of database: 277 Effective search space: 68142 Effective search space used: 68142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory