Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate Ac3H11_1332 Acetylornithine aminotransferase (EC 2.6.1.11)
Query= BRENDA::P42588 (459 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1332 Length = 398 Score = 222 bits (566), Expect = 1e-62 Identities = 148/370 (40%), Positives = 203/370 (54%), Gaps = 22/370 (5%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALT 137 D G+E+ID LGG + +GH + +V A+Q+Q+AK S PL+ LA L L+ Sbjct: 33 DVNGKEYIDGLGGIAVNTLGHNHGKLVPALQDQIAKLIHTSNYYHVPLQEKLATKLVELS 92 Query: 138 PGKLKYSFFCNSGTESVEAALKLAKAYQSPRG--KFTFIATSGAFHGKSLGALSATAKST 195 ++ FFCNSG E+ EAALK+A+ + +G K + AFHG+S+ +SAT Sbjct: 93 G--MQNVFFCNSGLEANEAALKIARKFGVDKGIAKPEIVVYEKAFHGRSIATMSATGNPK 150 Query: 196 FRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPGYLT 255 F PL+ GF VP +IEA++ A + +V AV E IQGEGG+ YL Sbjct: 151 IHNGFGPLVEGFVRVPMNDIEAIKQAT----EGNPNVVAVFFETIQGEGGINGMRIEYLQ 206 Query: 256 AVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIAT 315 +RKLCDE G LM++DEVQ GMGRTGK FA + + PD++ LAK LG GV PIGA +A Sbjct: 207 QLRKLCDERGWLMMIDEVQCGMGRTGKWFAHQWAGIVPDVMPLAKGLGSGV-PIGAVVAG 265 Query: 316 EEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAR 375 + +VL P H TTFGGNPLA A + TI ++ E L A Q GD L ++ Sbjct: 266 PKAANVL--QPGNHGTTFGGNPLAMRAGVETIRIMEEDGLLHNAAQVGDHLRAALQRELG 323 Query: 376 EYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNA---KTIRIEPPLT 432 P V+E RG+G+++ IE N R AG L + IR+ PPL Sbjct: 324 SLPG-VKEIRGQGLMLGIEL-------NKPCGALIGRAAEAGLLLSVTADSVIRLVPPLI 375 Query: 433 LTIEQCELVI 442 LT + + ++ Sbjct: 376 LTTAEADAIV 385 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 20 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 398 Length adjustment: 32 Effective length of query: 427 Effective length of database: 366 Effective search space: 156282 Effective search space used: 156282 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory