Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate Ac3H11_2066 SN-glycerol-3-phosphate transport ATP-binding protein UgpC (TC 3.A.1.1.3)
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2066 Length = 355 Score = 276 bits (706), Expect = 6e-79 Identities = 160/361 (44%), Positives = 220/361 (60%), Gaps = 17/361 (4%) Query: 2 TGLLLKDIRKSYG----AVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITG 57 + L + I K +G +V+V+ +D+ + GEF++ VGPSGCGKSTLL +IAGL+E T Sbjct: 3 SSLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTE 62 Query: 58 GDMFIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGA 117 G++ I G+ V +PP R IAMVFQSYALYP ++V DN+ F + + + K E +R+ Sbjct: 63 GEIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEV 122 Query: 118 ADMLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIA 177 A MLQ++ LDR P LSGGQRQRVA+GRA+ R P++FLFDEPLSNLDA LRV R EI Sbjct: 123 AAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIK 182 Query: 178 KLSERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGS 237 +L + S T +YVTHDQVEAMTL RI V+ G ++Q+G P E+Y RPAN +VA FIGS Sbjct: 183 RL-HQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFIGS 241 Query: 238 PAMNVIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTEADDFL 297 P MN++ + TG Q + G ++ L P +++ GVRPE L + E Sbjct: 242 PTMNLLRGAV--TGGQFGIQ---GAALNLAPPPSSANE---VLLGVRPEHLVMQETAP-- 291 Query: 298 FEGTVSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFDTNG 357 + G VS+VE G T + ++ + + + RV G+ V A H FD Sbjct: 292 WRGRVSVVEPTGPDTYVMVDTAAGS--VTLRTDAQTRVQPGEHVGLALAPAHAHWFDAQS 349 Query: 358 Q 358 + Sbjct: 350 E 350 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 355 Length adjustment: 29 Effective length of query: 333 Effective length of database: 326 Effective search space: 108558 Effective search space used: 108558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory