Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate Ac3H11_2066 SN-glycerol-3-phosphate transport ATP-binding protein UgpC (TC 3.A.1.1.3)
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2066 Length = 355 Score = 283 bits (725), Expect = 4e-81 Identities = 164/378 (43%), Positives = 225/378 (59%), Gaps = 30/378 (7%) Query: 2 TTLKLDNIYKRYPNAKHYSVENFNLDIH--DKEFIVFVGPSGCGKSTTLRMIAGLEDITE 59 ++L + I KR+ +DIH EF++ VGPSGCGKST L +IAGL++ TE Sbjct: 3 SSLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTE 62 Query: 60 GNLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEA 119 G + I K + P+DRDIAMVFQ+YALYP +SV +N+ F L++RK K + KR+ E Sbjct: 63 GEIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEV 122 Query: 120 AEILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIA 179 A +L ++ L+R+P+ LSGGQRQRVAMGRA+ R ++FL DEPLSNLDAKLRV MRAEI Sbjct: 123 AAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIK 182 Query: 180 KIHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPAN 239 ++H+ G T++YVTHDQ EAMTL RI +M G ++Q+GTP E+YN PAN Sbjct: 183 RLHQASGITSVYVTHDQVEAMTLGSRIAVMKG----------GVVQQLGTPDEIYNRPAN 232 Query: 240 KFVAGFIGSPAMNFFEVTVEKERL-VNQDGLSLALPQGQEKILEEKGYLGKKVTLGIRPE 298 +VA FIGSP MN V + + L+LA P +V LG+RPE Sbjct: 233 TYVATFIGSPTMNLLRGAVTGGQFGIQGAALNLAPPPSS----------ANEVLLGVRPE 282 Query: 299 DISSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEKVQL 358 + ++ ET P + V E G ++ + V + T R +A+ PGE V L Sbjct: 283 HL----VMQETAP---WRGRVSVVEPTGPDTYVMVDTAAGSVTLRTDAQTRVQPGEHVGL 335 Query: 359 TFNIAKGHFFDLETEKRI 376 A H+FD ++E+R+ Sbjct: 336 ALAPAHAHWFDAQSEERL 353 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 355 Length adjustment: 30 Effective length of query: 347 Effective length of database: 325 Effective search space: 112775 Effective search space used: 112775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory