Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate Ac3H11_2941 Various polyols ABC transporter, ATP-binding component
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2941 Length = 350 Score = 288 bits (737), Expect = 2e-82 Identities = 153/312 (49%), Positives = 202/312 (64%), Gaps = 14/312 (4%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIA 80 +K +L I GEF+V VGPSGCGKST LR++AGLE + G++ + +D+T RD+A Sbjct: 19 IKGIDLTIQQGEFIVFVGPSGCGKSTLLRLIAGLEAIDGGSLMLDGRDITDQPSSKRDLA 78 Query: 81 MVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQ 140 MVFQ+YALYPHM+V ENM FALK+A + I+++V AA L LT++L+R PK LSGGQ Sbjct: 79 MVFQSYALYPHMSVYENMSFALKLAKVDKQVIDEKVQNAARILNLTQYLQRTPKELSGGQ 138 Query: 141 RQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEAL 200 RQRVA+GRAIVR P+VFL DEPLSNLDA LR QTR +IA L R LG TT+YVTHDQ EA+ Sbjct: 139 RQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQTRVEIAKLHRDLGATTIYVTHDQVEAM 198 Query: 201 TMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGTFSVKDGDATSGHARI 260 T+ DR+ VL+DG ++QVG P ELYD+PAN FVA FIG+P MN+ ++ Sbjct: 199 TLADRVVVLRDGIIEQVGTPLELYDKPANQFVAQFIGTPQMNVVPVD-----------KL 247 Query: 261 KLSPETLAAMTPEDNGRITIGFRPEALEIIPEGESTDLSIPIKLDFVEELGSDSFLYGKL 320 + A P IG RPE + + G + + ++D +E LG+++ +Y Sbjct: 248 PQPVQQQAPAAPAGAAVGAIGLRPENITVRTTGAT---PVGGQVDLIEALGAETLIYVTT 304 Query: 321 VGEGDLGSSSED 332 G S D Sbjct: 305 PGGAQFVSRQND 316 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 350 Length adjustment: 29 Effective length of query: 347 Effective length of database: 321 Effective search space: 111387 Effective search space used: 111387 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory