Align ABC-type sugar transport system, periplasmic component protein (characterized, see rationale)
to candidate Ac3H11_3035 Fructose ABC transporter, substrate-binding component FrcB
Query= uniprot:D8IZC6 (316 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3035 Length = 337 Score = 99.4 bits (246), Expect = 1e-25 Identities = 92/296 (31%), Positives = 136/296 (45%), Gaps = 21/296 (7%) Query: 2 IKNTIAIACSTLLLAAAAQPAMAADKPLKSV-GVTVGDLANPFFVAIAKGAESGAHKINP 60 ++ T A A S L L A +A + + V G+ NPFFV + +GA + A K+ Sbjct: 1 MQRTPAFALSALALTGALACGLAQAQTSEPVIGLITKTETNPFFVKMKEGATAEAKKLG- 59 Query: 61 DAKVTVVSSKYDLNT--QVGQIENFIANKVDLIVLNAADSKGVGPAVKKAQKAGIVVVAV 118 AK+ + K D + QV +EN IA I++ +D+K + PA+KKAQ G++V+A+ Sbjct: 60 -AKLVSAAGKTDGDNAGQVTAMENLIAAGAKTILITPSDAKAIVPAIKKAQAKGVMVIAL 118 Query: 119 DVAAAGADVT---VMSDNTMAGAESCKFLAEKLQGKGNVV----IVNGPPVSAVMD---- 167 D D T +DN AG ++ GK V+ + G PV A Sbjct: 119 DSPTEPMDATDALFATDNYKAGELIGQYAKAAAAGKKPVIATLDLFPGHPVGAQRHNGFL 178 Query: 168 RVTGCKAEFKKSPGIKILSD---NQNAGGSRDGGMTTMSNLLAAQPKIDAVFAINDPTAI 224 + G +A KS + ++ ++ G R G T M N L P I+ V+ IN+P A Sbjct: 179 KGFGLQANDAKSNELSRPAEVVCMADSFGDRAKGQTGMENCLQKNPDINIVYTINEPAAA 238 Query: 225 GAELAIRQAKRSDIKWISGVDGAPDAERALKDSKSLFAASPAQDPYGMAAESVAIG 280 GA A++ A + I VDG K + AA+ Q P MAA VA G Sbjct: 239 GAYNALKAAGKEKNVLIVSVDGG--CAGIADVGKGVIAATSQQYPLRMAAMGVAAG 292 Lambda K H 0.314 0.129 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 337 Length adjustment: 28 Effective length of query: 288 Effective length of database: 309 Effective search space: 88992 Effective search space used: 88992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory