GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS03640 in Acidovorax sp. GW101-3H11

Align Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale)
to candidate Ac3H11_2881 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

Query= uniprot:D8IZC7
         (521 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2881 Ribose ABC
           transport system, ATP-binding protein RbsA (TC
           3.A.1.2.1)
          Length = 496

 Score =  380 bits (977), Expect = e-110
 Identities = 213/498 (42%), Positives = 302/498 (60%), Gaps = 11/498 (2%)

Query: 7   LQMRGIRKSFGATLALSDMHLTIRPGEIHALMGENGAGKSTLMKVLSGVHAPDQGEILLD 66
           ++ R + K FG    L  +   ++PG ++ L+GENGAGKSTLMK+L+G  +P  GE+++D
Sbjct: 5   VEFRNVTKEFGPVRVLHGVGFALQPGRVYGLLGENGAGKSTLMKILAGYESPTTGEVVVD 64

Query: 67  GRPVALRDPG----ASRAAGINLIYQELAVAPNISVAANVFMGSELRTRLGLIDHAAMRS 122
           G   A+R PG    A+ A GI LI+QE  +A ++++A N+F+G E++  L  +D  AMR 
Sbjct: 65  G---AVRAPGGGSRAAEAQGIVLIHQEFNLADDLTIAQNIFLGHEIKRGL-FLDDKAMRE 120

Query: 123 RTDAVLRQLGAGFGASDLAGRLSIAEQQQVEIARALVHRSRIVIMDEPTAALSERETEQL 182
           +T   L ++G          +L +AE+Q VEIARAL   +R++IMDEPTA L+  ETE+L
Sbjct: 121 KTREALAKVGLPLDPDTRVRKLIVAEKQLVEIARALARNARLLIMDEPTATLTPGETERL 180

Query: 183 FNVVRRLRDEGLAIIYISHRMAEVYALADRVTVLRDGSFVGELVRDEIDSERIVQMMVGR 242
           F ++  L+  G+ IIYISH++ EV    D V V+RDG  V       +   ++  +MVGR
Sbjct: 181 FALMAGLKAAGVTIIYISHKLDEVERTTDEVVVMRDGLLVAREATASVTRRQMANLMVGR 240

Query: 243 SLSEFYQHQRIAPADAAQLPTVMQVRALAGGKIRPASFDVRAGEVLGFAGLVGAGRTELA 302
            L++ +  +  AP D A   TV  +     G      F+VR GE+LGFAGLVGAGRTEL 
Sbjct: 241 ELADLFPPKLPAPQDGAPAITVRGLTV--PGWAEGVDFEVRRGEILGFAGLVGAGRTELF 298

Query: 303 RLLFGADPRSGGDILLEGRPVHIDQPRAAMRAGIAYVPEDRKGQGLFLQMAVAANATMNV 362
             L G  PR+ G + + G+PV +  PR A R G+ Y+ EDRKG+GL +   +  N T+  
Sbjct: 299 EGLLGLRPRTAGTVEIAGQPVQLKSPRDAARHGLTYLSEDRKGKGLHVHFGLRPNLTLMA 358

Query: 363 ASRHTRLGLVRSRSLGGVARAAIQRLNVKVAHPETPVGKLSGGNQQKVLLARWLEIAPKV 422
             R+ +  L  +     + R A+Q   ++    E     LSGGNQQK+ LA+ L   P V
Sbjct: 359 LERYAKPWLDPAAEQAAL-REAVQEFGIRTGSLEVRASSLSGGNQQKLALAKVLHPGPSV 417

Query: 423 LILDEPTRGVDIYAKSEIYQLVHRLASQGVAVVVISSELPEVIGICDRVLVMREGMITGE 482
           ++LDEPTRGVD+ AK EIY LV RLA QG+AV+VISSEL E+IG+C RV VMR G +   
Sbjct: 418 VVLDEPTRGVDVGAKREIYHLVQRLAEQGLAVIVISSELMELIGLCHRVAVMRAGRLQTT 477

Query: 483 LAGAAITQENIMRLATDT 500
           L    +T+E ++  AT T
Sbjct: 478 LQEPHLTEEELIAHATGT 495



 Score = 80.1 bits (196), Expect = 2e-19
 Identities = 69/258 (26%), Positives = 124/258 (48%), Gaps = 20/258 (7%)

Query: 267 VRALAGGKIRPASFDVRAGEVLGFAGLVGAGRTELARLLFGADPRSGGDILLEGRPVHID 326
           VR L G       F ++ G V G  G  GAG++ L ++L G +  + G+++++G    + 
Sbjct: 17  VRVLHG-----VGFALQPGRVYGLLGENGAGKSTLMKILAGYESPTTGEVVVDGA---VR 68

Query: 327 QP----RAAMRAGIAYVPEDRKGQGLFLQMAVAANATMNVASRHTRLGL-VRSRSLGGVA 381
            P    RAA   GI  + ++     L   + +A N  +       + GL +  +++    
Sbjct: 69  APGGGSRAAEAQGIVLIHQEFN---LADDLTIAQNIFLG---HEIKRGLFLDDKAMREKT 122

Query: 382 RAAIQRLNVKVAHPETPVGKLSGGNQQKVLLARWLEIAPKVLILDEPTRGVDIYAKSEIY 441
           R A+ ++ + +  P+T V KL    +Q V +AR L    ++LI+DEPT  +       ++
Sbjct: 123 REALAKVGLPL-DPDTRVRKLIVAEKQLVEIARALARNARLLIMDEPTATLTPGETERLF 181

Query: 442 QLVHRLASQGVAVVVISSELPEVIGICDRVLVMREGMITGELAGAAITQENIMRLATDTN 501
            L+  L + GV ++ IS +L EV    D V+VMR+G++    A A++T+  +  L     
Sbjct: 182 ALMAGLKAAGVTIIYISHKLDEVERTTDEVVVMRDGLLVAREATASVTRRQMANLMVGRE 241

Query: 502 VPRTAPASHSSPTPLAPS 519
           +    P    +P   AP+
Sbjct: 242 LADLFPPKLPAPQDGAPA 259


Lambda     K      H
   0.320    0.135    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 717
Number of extensions: 45
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 521
Length of database: 496
Length adjustment: 34
Effective length of query: 487
Effective length of database: 462
Effective search space:   224994
Effective search space used:   224994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory