Align Glucose transport system permease protein aka TT_C0327, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate Ac3H11_2064 ABC-type sugar transport system, permease component
Query= TCDB::Q72KX3 (369 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2064 Length = 293 Score = 167 bits (422), Expect = 4e-46 Identities = 116/357 (32%), Positives = 176/357 (49%), Gaps = 83/357 (23%) Query: 9 LVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTGFVD 68 LV+ P+ + F+YG + N +SLT + P + GL Y L+ +D Sbjct: 13 LVVAPAFVLGFAFIYGLMVWNGVLSLT--------VSRMLPNYEWAGLAQYERLWE--MD 62 Query: 69 VRFRQSVVNLIFFTLFFMAGSLGLGLLLALAVDKAPRGEGFFRTVFLFPMALSFVVTGTI 128 R+ ++ NL F + ++ GSL +G++LA+ +D+ R EG RT++L+PMALSFVVTGT Sbjct: 63 -RWWVALKNLGIFGVGYVGGSLLIGVVLAVLLDQKIRAEGALRTIYLYPMALSFVVTGTA 121 Query: 129 WRWLLQPQGGVNVLPTLFGLPPLSFPWLATREQVLVFDWNRLPFYTALVVGLVLLYVAYT 188 W+WLL P G+ + +G P F WL E + Y ++ G Sbjct: 122 WKWLLNPGLGIEKMVRDWGFPNFEFGWLVDTEMAI---------YCVVIAG--------- 163 Query: 189 AYREGERRRALWGLASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGY 248 +W A GF++AL Sbjct: 164 ---------------------IWQSA--------------GFAMAL-------------- 174 Query: 249 TMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDL 308 +LAGLRGI +++AA+VDGAS +++ R++ P L P+ S ++VL H+A+K FDL Sbjct: 175 ----FLAGLRGIDDSIIKAAQVDGASLPRIYWRIVLPALRPVFFSTLMVLSHLAIKSFDL 230 Query: 309 VFAM-AGLDYAPTDVPAIYMYLLAFRGNQFAKGAAIGILLLLLVAVVVVPYLATQLR 364 V A+ AG TDVPA +MY ++F Q GAA ++L VA +V+PYL ++LR Sbjct: 231 VMALTAGGPGFATDVPATFMYTMSFSRGQIGLGAASATMMLATVAALVIPYLYSELR 287 Lambda K H 0.331 0.146 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 369 Length of database: 293 Length adjustment: 28 Effective length of query: 341 Effective length of database: 265 Effective search space: 90365 Effective search space used: 90365 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory