Align Rhizopine-binding protein (characterized, see rationale)
to candidate Ac3H11_611 Putative sugar ABC transport system, periplasmic binding protein YtfQ precursor
Query= uniprot:A0A0N9WNI6 (308 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_611 Length = 322 Score = 127 bits (318), Expect = 5e-34 Identities = 94/303 (31%), Positives = 158/303 (52%), Gaps = 15/303 (4%) Query: 8 ASLALSLMLASGA-ALADLRIGVSMSQFDDTWLTYLRESMDKQAKSMPDGVKLQFEDARS 66 AS+ ++ +L S A A L +G S + W T ES+ AK G++L+F DA+ Sbjct: 14 ASVPVAALLPSTAWAQKPLVLGFSQVGAESEWRTANTESIKSAAKEA--GIELKFSDAQQ 71 Query: 67 DVVKQLSQVESFISQKVDAIVVNPVDTAATRKITEAAVKAGIPLVYVNRRPDDLKLPKGV 126 Q+ + SFI+QKVD I +PV + + A A IP+V +R + V Sbjct: 72 KQENQIKAIRSFIAQKVDVIAFSPVVESGWEPVLREAKAAKIPVVLTDRAVNTKDTSLYV 131 Query: 127 ITVASNDLEAGQMQMQYLAEKM---KGKGDIVILLGDLANNSTTNRTKGVKEVLAKYPGI 183 + S+ +E G+ ++L EKM KG+ +IV L G + + +R KG +E++ P Sbjct: 132 TFMGSDFVEEGRKAGRWLVEKMKDQKGEVNIVELQGTVGSAPAIDRKKGFEEIIKADPKF 191 Query: 184 KIDQEQTGTWSRDKGMTLVNDWL-TQGRKFDAIVSNNDEMAIGAAMALKQAGVEKG-SVL 241 KI + QTG ++R KG ++ +L +G+K + + ++ND+MAIGA A+++AG++ ++ Sbjct: 192 KIIRSQTGDFTRAKGKEVMEAFLKAEGKKINVLYAHNDDMAIGAIQAIEEAGMKPAKDIV 251 Query: 242 IAGVDGTPDGLRAVKKGDLAVSVFQDANGQAVDSIDAAVKMAKNEPVEQAVWVPYRLITP 301 I +D A+ G L VSV + + + AAVK ++ VP R++T Sbjct: 252 IISIDAVKGAFEAMIAGKLNVSV--ECSPLLGPQLMAAVK-----DIKAGKAVPKRIVTE 304 Query: 302 ENV 304 E + Sbjct: 305 EGI 307 Lambda K H 0.315 0.130 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 322 Length adjustment: 27 Effective length of query: 281 Effective length of database: 295 Effective search space: 82895 Effective search space used: 82895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory