GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_11890 in Acidovorax sp. GW101-3H11

Align m-Inositol ABC transporter, ATPase component (itaA) (characterized)
to candidate Ac3H11_607 Predicted L-arabinose ABC transport system, ATP-binding protein

Query= reanno::pseudo3_N2E3:AO353_21385
         (521 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_607 Predicted
           L-arabinose ABC transport system, ATP-binding protein
          Length = 517

 Score =  361 bits (927), Expect = e-104
 Identities = 197/493 (39%), Positives = 308/493 (62%), Gaps = 15/493 (3%)

Query: 17  PNAIPVDEPYLLEIINVSKGFPGVVALSDVQLRVRPGSVLALMGENGAGKSTLMKIIAGI 76
           P A PV     L++  + K F G+  L DVQL + PG + ALMG+NGAGKSTL+K++ G+
Sbjct: 13  PAAAPV-----LQLSGIHKQFAGITVLRDVQLNLYPGEIHALMGQNGAGKSTLIKVLTGV 67

Query: 77  YQPDAGELRLRGKPVTFDTPLAALQAGIAMIHQELNLMPHMSIAENIWIGREQLNGFHM- 135
            +   G++RL G+ V  D+PLAA + GI+ ++QE+NL P++S+AENI+ GR    G    
Sbjct: 68  LEASGGQMRLGGQAVWPDSPLAAQRLGISTVYQEVNLCPNLSVAENIFAGRYPRCGIAQG 127

Query: 136 --IDHREMHRCTAQLLERLRINLDPEEQVGNLSIAERQMVEIAKAVSYDSDILIMDEPTS 193
             ID   +H+    L+ R+ + +D    + +  +A +Q+V IA+A+S +S +LI+DEPTS
Sbjct: 128 FRIDWATLHQRARDLVARIGLQIDVTRLLSDYPVAVQQLVAIARALSIESRVLILDEPTS 187

Query: 194 AITDKEVAHLFSIIADLKAQGKGIIYITHKMNEVFSIADEVAVFRDGAYIGLQRADSMDG 253
           ++ D EV  LF ++  L+++G  I+++TH +N+V++++D + V R+G+++G   A  +  
Sbjct: 188 SLDDDEVQKLFEVLRRLRSEGLSIVFVTHFLNQVYAVSDRITVLRNGSWVGEWLAKDLGP 247

Query: 254 DSLISMMVGRELSQLF------PVREKPIGDLLMSVRDLRLDGVFKGVSFDLHAGEILGI 307
            +LI+ M+GR+L+         P  +    +LL +   L  D   + +   + AGE++G+
Sbjct: 248 QALIAAMLGRDLAAASEQPAPAPAVDSRHANLLQA-EGLGQDTQLQPLDLQIRAGEVVGL 306

Query: 308 AGLMGSGRTNVAEAIFGITPSDGGEICLDGQPVRISDPHMAIEKGFALLTEDRKLSGLFP 367
           AGL+GSGRT +A  +FG+   D G + +DGQ V+ ++P  AI  G AL  E+RK  G+  
Sbjct: 307 AGLLGSGRTELARLLFGLEQPDRGALRIDGQVVKFANPMDAIRHGLALCPEERKTDGIVA 366

Query: 368 CLSVLENMEMAVLPHYAGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQQKA 427
            LSV EN+ +A+        F+ +     L E   K L +KT ++++ I  LSGGNQQKA
Sbjct: 367 ELSVRENIALALQARMGVGKFLSRSEQTELAERYVKLLGIKTETVDKPIGLLSGGNQQKA 426

Query: 428 LLARWLMTNPRILILDEPTRGIDVGAKAEIYRLISYLASEGMAVIMISSELPEVLGMSDR 487
           +LARW+   PR+LILDEPTRGIDV AK EI   I  LA  GMAV+ ISSE+ EV+ ++ R
Sbjct: 427 ILARWMAIEPRLLILDEPTRGIDVAAKQEIMDQILRLAQAGMAVLFISSEMSEVVRVAHR 486

Query: 488 VMVMHEGDLMGTL 500
           ++V+ +   +G L
Sbjct: 487 IVVLRDRRKVGEL 499



 Score = 94.0 bits (232), Expect = 1e-23
 Identities = 64/257 (24%), Positives = 124/257 (48%), Gaps = 6/257 (2%)

Query: 1   MFASATASSIPLVGVQPNAIPVDEPYLLEIINVSKGFPGVVALSDVQLRVRPGSVLALMG 60
           + A+     +     QP   P  +     ++  ++G      L  + L++R G V+ L G
Sbjct: 250 LIAAMLGRDLAAASEQPAPAPAVDSRHANLLQ-AEGLGQDTQLQPLDLQIRAGEVVGLAG 308

Query: 61  ENGAGKSTLMKIIAGIYQPDAGELRLRGKPVTFDTPLAALQAGIAMIHQELN---LMPHM 117
             G+G++ L +++ G+ QPD G LR+ G+ V F  P+ A++ G+A+  +E     ++  +
Sbjct: 309 LLGSGRTELARLLFGLEQPDRGALRIDGQVVKFANPMDAIRHGLALCPEERKTDGIVAEL 368

Query: 118 SIAENIWIGREQLNGF-HMIDHREMHRCTAQLLERLRINLDP-EEQVGNLSIAERQMVEI 175
           S+ ENI +  +   G    +   E      + ++ L I  +  ++ +G LS   +Q   +
Sbjct: 369 SVRENIALALQARMGVGKFLSRSEQTELAERYVKLLGIKTETVDKPIGLLSGGNQQKAIL 428

Query: 176 AKAVSYDSDILIMDEPTSAITDKEVAHLFSIIADLKAQGKGIIYITHKMNEVFSIADEVA 235
           A+ ++ +  +LI+DEPT  I       +   I  L   G  +++I+ +M+EV  +A  + 
Sbjct: 429 ARWMAIEPRLLILDEPTRGIDVAAKQEIMDQILRLAQAGMAVLFISSEMSEVVRVAHRIV 488

Query: 236 VFRDGAYIGLQRADSMD 252
           V RD   +G   A S +
Sbjct: 489 VLRDRRKVGELPAGSSE 505


Lambda     K      H
   0.321    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 620
Number of extensions: 24
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 521
Length of database: 517
Length adjustment: 35
Effective length of query: 486
Effective length of database: 482
Effective search space:   234252
Effective search space used:   234252
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory