Align BadK (characterized)
to candidate Ac3H11_4989 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4989 Length = 266 Score = 124 bits (311), Expect = 2e-33 Identities = 82/257 (31%), Positives = 129/257 (50%), Gaps = 5/257 (1%) Query: 5 PILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAG 64 P+L E +G + + NRP+ LNA++ + +A A+ AD + A+V+ GN R F AG Sbjct: 12 PLLLEREGAIATLRFNRPEALNAIDVPMANAFLAAVQTVAADPAVRAVVLCGNGRGFMAG 71 Query: 65 ADIASMAA---WSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVI 121 D+A++ A S D+ + + Q+ PV+A V G+A G G L L D VI Sbjct: 72 GDLATLRADPVQSAIDILTP--LNAALLLLAQMNAPVVAQVHGVAAGAGLSLLLMADYVI 129 Query: 122 AGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVV 181 A + L I LG G + LPR +G +A+++ L A++A R GLV+RVV Sbjct: 130 AAEGTRLNLAYINLGTSCDVGASWALPRIVGVRQALEIALLGDAFTADDALRLGLVNRVV 189 Query: 182 DDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAR 241 L T ALA +A+ A A+K + + + TL E + E+ + D R Sbjct: 190 PAAELDSATAALAQRLASGPTLAYGAMKRLMRASMDHTLPEQLAAEKDAFVHCAGTEDFR 249 Query: 242 EGIQAFLEKRAPCFSHR 258 G++AF +++ F+ R Sbjct: 250 AGVEAFHLRQSASFAGR 266 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 266 Length adjustment: 25 Effective length of query: 233 Effective length of database: 241 Effective search space: 56153 Effective search space used: 56153 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory