Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate Ac3H11_2719 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::P76082 (255 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2719 Length = 271 Score = 149 bits (377), Expect = 4e-41 Identities = 96/262 (36%), Positives = 138/262 (52%), Gaps = 10/262 (3%) Query: 4 LIVSRQQRVLLLTLNRPAARNALNNALLM-QLVNELEAAATDTSISVCVITGNARFFAAG 62 L++ R VL LNRP RNAL + M +LV D SI V+TG F AG Sbjct: 10 LLIERDGPVLTARLNRPETRNALTDPAHMDELVALCRQIRADHSIKALVLTGEGSAFCAG 69 Query: 63 ADLNEMAEK---------DLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALL 113 ++ +M ++ ++ + DT ++ L + P+IAAVNG A+GAG +LA + Sbjct: 70 GNVKDMQQRGGIFAGSPYEVRDSYRDTIQRIPLALYELDVPVIAAVNGPAIGAGLDLACM 129 Query: 114 CDVVVAGENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGL 173 CD+ +A + A F + +GI+PG GG L R +G AS + +G++I A +A GL Sbjct: 130 CDIRIASDKALFAESFVKVGIVPGDGGAWLLPRVIGMPKASLLAFTGDTIDAAKALSWGL 189 Query: 174 VSDVFPSDLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAA 233 V+DVFP+D L A LA ++A + AL+ K+ LR+ Q V L L L Sbjct: 190 VADVFPADQLLGQAQALAQRIALNPSHALRLTKRLLREGQHVRLDTLLELSSAYQALSHH 249 Query: 234 TEDRHEGISAFLQKRTPDFKGR 255 TED E ++AFL KR F GR Sbjct: 250 TEDHLEAVNAFLDKRPAQFTGR 271 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 109 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 271 Length adjustment: 25 Effective length of query: 230 Effective length of database: 246 Effective search space: 56580 Effective search space used: 56580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory