Align Phenylalanine 4-monooxygenase (EC 1.14.16.1) (characterized)
to candidate Ac3H11_1847 Phenylalanine-4-hydroxylase (EC 1.14.16.1)
Query= reanno::acidovorax_3H11:Ac3H11_1847 (290 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1847 Length = 290 Score = 590 bits (1520), Expect = e-173 Identities = 290/290 (100%), Positives = 290/290 (100%) Query: 1 VRKVMAAKEKKMGQAPVVYGQSTRPPRGDYSRANADYTCPQDYAAYTDADHDTYRRLYER 60 VRKVMAAKEKKMGQAPVVYGQSTRPPRGDYSRANADYTCPQDYAAYTDADHDTYRRLYER Sbjct: 1 VRKVMAAKEKKMGQAPVVYGQSTRPPRGDYSRANADYTCPQDYAAYTDADHDTYRRLYER 60 Query: 61 QRALLPGLASQAFIDALPSLGASDQIPRFEEVNERLYKATGWELVGVPGLIPEVPFFTLL 120 QRALLPGLASQAFIDALPSLGASDQIPRFEEVNERLYKATGWELVGVPGLIPEVPFFTLL Sbjct: 61 QRALLPGLASQAFIDALPSLGASDQIPRFEEVNERLYKATGWELVGVPGLIPEVPFFTLL 120 Query: 121 ANRQFPVTDWIRKPEEFEYIVEPDIFHDLFGHVPLLFNPVFADYVQRYGQGGLKAQGLGS 180 ANRQFPVTDWIRKPEEFEYIVEPDIFHDLFGHVPLLFNPVFADYVQRYGQGGLKAQGLGS Sbjct: 121 ANRQFPVTDWIRKPEEFEYIVEPDIFHDLFGHVPLLFNPVFADYVQRYGQGGLKAQGLGS 180 Query: 181 CEMLSRLYWYTIEFGLIREAGELRAYGAGILSSSGELAYSVQSPEPQRIPLALERTMRTR 240 CEMLSRLYWYTIEFGLIREAGELRAYGAGILSSSGELAYSVQSPEPQRIPLALERTMRTR Sbjct: 181 CEMLSRLYWYTIEFGLIREAGELRAYGAGILSSSGELAYSVQSPEPQRIPLALERTMRTR 240 Query: 241 YKIDTYQQTYFVIDSFEQLFEMTAADFAPIYERLRGLPEFAADEREAVAA 290 YKIDTYQQTYFVIDSFEQLFEMTAADFAPIYERLRGLPEFAADEREAVAA Sbjct: 241 YKIDTYQQTYFVIDSFEQLFEMTAADFAPIYERLRGLPEFAADEREAVAA 290 Lambda K H 0.321 0.139 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 290 Length adjustment: 26 Effective length of query: 264 Effective length of database: 264 Effective search space: 69696 Effective search space used: 69696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_1847 (Phenylalanine-4-hydroxylase (EC 1.14.16.1))
to HMM TIGR01267 (phhA: phenylalanine-4-hydroxylase (EC 1.14.16.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01267.hmm # target sequence database: /tmp/gapView.25610.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01267 [M=248] Accession: TIGR01267 Description: Phe4hydrox_mono: phenylalanine-4-hydroxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-104 334.2 0.0 2.5e-104 333.9 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1847 Phenylalanine-4-hydroxylase (EC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1847 Phenylalanine-4-hydroxylase (EC 1.14.16.1) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 333.9 0.0 2.5e-104 2.5e-104 1 241 [. 36 276 .. 36 282 .. 0.98 Alignments for each domain: == domain 1 score: 333.9 bits; conditional E-value: 2.5e-104 TIGR01267 1 dftvaqdldryseeehavwatlidrqlkllegracdeyldGveklgldadripdleevnekl 62 d+t +qd+ y++ +h +++ l++rq ll+g+a + ++d + lg d+ip +eevne+l lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1847 36 DYTCPQDYAAYTDADHDTYRRLYERQRALLPGLASQAFIDALPSLGA-SDQIPRFEEVNERL 96 6899******************************************9.9************* PP TIGR01267 63 raltGwkivavpglipadvffehlanrrfpvttflrtpeeldylqepdvfhdlfGhvpllsn 124 ++tGw++v vpglip+ +ff +lanr+fpvt ++r+pee++y++epd+fhdlfGhvpll n lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1847 97 YKATGWELVGVPGLIPEVPFFTLLANRQFPVTDWIRKPEEFEYIVEPDIFHDLFGHVPLLFN 158 ************************************************************** PP TIGR01267 125 pvfadfleayGkkgvkakalgaa.llarlywytvefGlvetaaglriyGaGilsskkelvya 185 pvfad+++ yG++g+ka+ lg+ +l+rlywyt+efGl+++a++lr+yGaGilss el y+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1847 159 PVFADYVQRYGQGGLKAQGLGSCeMLSRLYWYTIEFGLIREAGELRAYGAGILSSSGELAYS 220 *********************988************************************** PP TIGR01267 186 leskeplrvafdllevmrtryridklqkayfvlpslkrlfdaaqedfealvaeakd 241 ++s ep+r+++ l++ mrtry+id++q++yfv++s+++lf++++ df++++ +++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1847 221 VQSPEPQRIPLALERTMRTRYKIDTYQQTYFVIDSFEQLFEMTAADFAPIYERLRG 276 ***************************************************99865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.30 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory