Align Maleylacetoacetate isomerase; MAAI; EC 5.2.1.2 (uncharacterized)
to candidate Ac3H11_210 Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)
Query= curated2:P57109 (212 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_210 Length = 212 Score = 196 bits (497), Expect = 4e-55 Identities = 107/213 (50%), Positives = 141/213 (66%), Gaps = 8/213 (3%) Query: 1 MKLYTYYRSTSSYRVRIALALKGLDYQSLPVNLIRDGGEHRQPAYLALNPQGRVPALQVD 60 M+LY+++RS +S+R+RIAL LKGL Y+ + V+L R+ EH A+ A+NPQ VP L+ D Sbjct: 1 MRLYSFFRSGTSHRLRIALNLKGLAYEQVAVDLRRE--EHLGDAFKAINPQQFVPVLEAD 58 Query: 61 EGELLIQSPAIIEYLEERYPQPALLSSDPLRRARERGVAALVGCDIHPLHNASVLNLLR- 119 E L+IQSPAIIE+LEERYP P LL D RA+ R +AA+VGCDIHP++N +L LR Sbjct: 59 E-RLMIQSPAIIEWLEERYPTPPLLPGDAGDRAQVRALAAIVGCDIHPINNRRILEALRH 117 Query: 120 QWGHDEEQVRQWIGHWVGQGLAAVEQLIGDQ----GWCFGDRPGLADVYLVPQLYAAERF 175 ++G DE V W G W+ G A+E L+ +CFG P LADVYLVPQ+ +A RF Sbjct: 118 RFGADEAAVNDWCGTWISAGFDAIEALLSKDPQRGDFCFGSTPTLADVYLVPQVESARRF 177 Query: 176 GVALDAWPRIRRVADLAAAHPAFRQAHPANQPD 208 V L WP ++ V A AFR+A P+ QPD Sbjct: 178 KVDLARWPLVQAVDAACAQLEAFRKAAPSAQPD 210 Lambda K H 0.321 0.138 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 212 Length adjustment: 21 Effective length of query: 191 Effective length of database: 191 Effective search space: 36481 Effective search space used: 36481 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate Ac3H11_210 (Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18))
to HMM TIGR01262 (maiA: maleylacetoacetate isomerase (EC 5.2.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01262.hmm # target sequence database: /tmp/gapView.9931.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01262 [M=211] Accession: TIGR01262 Description: maiA: maleylacetoacetate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-89 284.0 0.0 3.8e-89 283.9 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_210 Maleylacetoacetate isomerase (EC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_210 Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 283.9 0.0 3.8e-89 3.8e-89 2 210 .. 3 211 .. 2 212 .] 0.99 Alignments for each domain: == domain 1 score: 283.9 bits; conditional E-value: 3.8e-89 TIGR01262 2 lYsyfrSsasyRvRiaLaLkgidyesvpvnLlkdGeqkkeefkalNPqelvPtLkidegevlt 64 lYs+frS++s+R+RiaL+Lkg++ye v+v+L+++ e+ ++fka+NPq+ vP+L+ de + + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_210 3 LYSFFRSGTSHRLRIALNLKGLAYEQVAVDLRRE-EHLGDAFKAINPQQFVPVLEADE-RLMI 63 9********************************7.**********************6.9*** PP TIGR01262 65 qSlAiieyLeetypepaLlpkdpakrarvralalliacdihPlqNlrvlqlleeklgvdeeek 127 qS Aiie+Lee+yp+p+Llp d+ +ra+vrala++++cdihP++N+r+l+ l++++g+de++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_210 64 QSPAIIEWLEERYPTPPLLPGDAGDRAQVRALAAIVGCDIHPINNRRILEALRHRFGADEAAV 126 *************************************************************** PP TIGR01262 128 kewlkhwiekGlaalEellk..ekagafcvGdevtladvcLvpqvynAerfevdlaqyPtlkr 188 ++w+ +wi++G++a+E+ll+ +++g+fc+G ++tladv+Lvpqv +A+rf+vdla++P++++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_210 127 NDWCGTWISAGFDAIEALLSkdPQRGDFCFGSTPTLADVYLVPQVESARRFKVDLARWPLVQA 189 *******************98899*************************************** PP TIGR01262 189 ieealaelpafqeahpenqpdt 210 +++a+a+l+af++a+p+ qpd+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_210 190 VDAACAQLEAFRKAAPSAQPDA 211 *********************6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (212 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.35 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory