Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate Ac3H11_4393 Aldehyde dehydrogenase (EC 1.2.1.3)
Query= BRENDA::P05091 (517 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4393 Length = 507 Score = 356 bits (913), Expect = e-102 Identities = 206/483 (42%), Positives = 286/483 (59%), Gaps = 20/483 (4%) Query: 40 FINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDAS 99 FI ++ V + F + P +G+V + A ED++ A+ AA AA W + DA+ Sbjct: 23 FIGGKFVPPVKGQYFDVITPVSGKVYTRAARSTAEDIELALDAAHAA---ADSWGKTDAA 79 Query: 100 HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGK 159 R +L ++A+ IE + LA ET+DNGK + D+ + + RY+AG G Sbjct: 80 TRANILLKIANRIEENLERLAYAETVDNGKAIRETLNADIPLTVDHFRYFAGCVRAQEGA 139 Query: 160 TIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL 219 ID + +Y EP+GV GQIIPWNFP+LM AWKL PAL GN VV+K AE TP++ L Sbjct: 140 LSNIDENTVAYHIQEPLGVVGQIIPWNFPILMAAWKLAPALGAGNCVVLKPAESTPISIL 199 Query: 220 YVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNL 279 + LI + PPGV+NIV GFG AG +A + + K+AFTGST GRVI AA ++NL Sbjct: 200 ILVELIADL-LPPGVLNIVNGFGREAGMPLAQSKRIAKIAFTGSTSTGRVIAQAA-ANNL 257 Query: 280 KRVTLELGGKSPNIIMS------DADMDWAVEQAHFALF-FNQGQCCCAGSRTFVQEDIY 332 TLELGGKSPNI + DA +D A+E LF FNQG+ C SR +QE IY Sbjct: 258 IPATLELGGKSPNIFFADIMDKDDAFLDKAIE--GLVLFAFNQGEVCTCPSRAIIQESIY 315 Query: 333 DEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIA- 391 D+F+ER + R + NP D+ + G Q + Q KIL Y++ GKQEGA++L GGG A Sbjct: 316 DQFMERVLKRVAAIKHQNPLDTDSMMGAQASKEQLTKILSYLDLGKQEGAEVLAGGGQAH 375 Query: 392 ----ADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAA 447 + GY++QPT+F + M I +EEIFGPV+ + FK E + AN++ YGL A Sbjct: 376 LGGDLEGGYYVQPTLFKG-HNKMRIFQEEIFGPVLAVTTFKDEAEALAIANDTLYGLGAG 434 Query: 448 VFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKT 507 V++++ + A + +A++AG VW NCY + A + FGGYK SG GRE + L Y + K Sbjct: 435 VWSRNGNVAYRMGRAIKAGRVWTNCYHAYPAHAAFGGYKESGIGRETHKMMLDHYQQTKN 494 Query: 508 VTV 510 + V Sbjct: 495 LLV 497 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 631 Number of extensions: 37 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 507 Length adjustment: 35 Effective length of query: 482 Effective length of database: 472 Effective search space: 227504 Effective search space used: 227504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory