Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate Ac3H11_4985 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)
Query= uniprot:G8ALI9 (505 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4985 Length = 345 Score = 150 bits (379), Expect = 7e-41 Identities = 102/331 (30%), Positives = 165/331 (49%), Gaps = 42/331 (12%) Query: 150 WLGPIAVVVALAFPFTPLADRQLLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAV 209 WL A ++ L FPF +A L + L+ + GLNI+ G GL+ LG AF + Sbjct: 25 WLAVGAALLVL-FPF--MASDYWLYLACLVSINVASATGLNILTGYTGLVSLGQAAFMGL 81 Query: 210 GAYSYALLAHYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIRII 269 GAY+ A+L G F + L GF+A + G+++G P LR++G Y AI T+ I I Sbjct: 82 GAYTVAVLETKVGTPFVLNLLAGGFVAMLGGIVVGIPSLRVKGLYLAIATIAASFIAHFI 141 Query: 270 LINWYQFTGGPNGISGIPRPSFFGIADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYLI 329 NW +FTGG G+S +P FG+A L LY+LI Sbjct: 142 FANW-KFTGGTGGLS-VPPAKLFGMA-----------------------LDTSFRLYWLI 176 Query: 330 LVLALVVNLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLAAFAIAAMFGGFAGS 389 + + +++ L + + +GRA+ A+R+ DI+ LGI KL +F +++ + G AG Sbjct: 177 VPVTILMLLGAANLFRTRVGRAFIAIRDRDISAEVLGIPLLRYKLLSFGLSSFYAGVAGG 236 Query: 390 FFATRQGFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIGLPEAFRELAD---- 445 +A ++PESF + S LA +++GGMGS +G ++ A + +PE + + D Sbjct: 237 LWAYFFRVVTPESFPLLMSIFFLAAIIVGGMGSILGGILGAVFMTMVPELLKLVVDLMPG 296 Query: 446 ----------YRMLAFGMGMVLIMLWRPRGL 466 R + FG+ ++ +++ P GL Sbjct: 297 GSELTVLLSPVRTVIFGLLIIGFLVFEPHGL 327 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 32 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 345 Length adjustment: 31 Effective length of query: 474 Effective length of database: 314 Effective search space: 148836 Effective search space used: 148836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory