Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate Ac3H11_4630 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)
Query= uniprot:G8ALJ0 (294 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4630 Length = 274 Score = 203 bits (516), Expect = 4e-57 Identities = 117/268 (43%), Positives = 169/268 (63%), Gaps = 10/268 (3%) Query: 1 MTTQSMTTTPLLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGF 60 MTT+ + +L V+++++RFGG+ A+ D+SF+ EI AIIGPNGAGK+++ NCI G Sbjct: 14 MTTKKIGDV-ILDVKNISLRFGGVKALTDISFNVKEHEIRAIIGPNGAGKSSMLNCINGV 72 Query: 61 YTPTVGRLTLRHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNK 120 YTP G +T R GK F M ++++ VARTFQN+ LF GMSV++N++ ++ K Sbjct: 73 YTPQDGSITFR---GKTF--SHMNSRQVAEMG-VARTFQNLALFKGMSVIDNIMTGRNLK 126 Query: 121 LIRASGFSIAGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIA 180 I+++ F A LG R E + ++ +D + + F G LPYG Q+R+++ Sbjct: 127 -IKSNLFLQALRLGPAE--REEMAHREKVEHIIDFLEIQAFRKTPVGQLPYGLQKRVDLG 183 Query: 181 RAMCTEPVMLCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVV 240 RA+ EP +L LDEP AG+N E ++ + + DE ++LIEHDM VVM ISD VV Sbjct: 184 RALAMEPQVLLLDEPMAGMNVEEKQDMCRFILDVNDEFGTTIVLIEHDMGVVMDISDRVV 243 Query: 241 VLDYGRKISDGDPAFVKNDPAVIRAYLG 268 VLDYG+KI DG P V+N+ VI AYLG Sbjct: 244 VLDYGKKIGDGTPDEVRNNQDVISAYLG 271 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 274 Length adjustment: 26 Effective length of query: 268 Effective length of database: 248 Effective search space: 66464 Effective search space used: 66464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory