Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate Ac3H11_4987 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)
Query= uniprot:G8ALJ1 (236 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4987 Length = 272 Score = 188 bits (478), Expect = 8e-53 Identities = 107/243 (44%), Positives = 154/243 (63%), Gaps = 9/243 (3%) Query: 1 MLKVSGVHTFYG-AIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICG-----SPRAR 54 +L+V+ + Y ++AL+G+ + + G+IV+L+G+NGAGKST L I G Sbjct: 9 VLEVNNIEVIYNKVVQALRGLSLAVPRGQIVALLGSNGAGKSTTLKAISGLLALEDGVVE 68 Query: 55 MGRITFEGQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGS--ITAKPGSFANE 112 G I F GQ + +LVR G++ EGRR+F ++V ENL + +T + G+ + Sbjct: 69 SGSIHFNGQPTAAVAPQQLVRNGLSHVMEGRRVFEDLTVEENLVAATYALTGRSGT-TPD 127 Query: 113 LERVLTLFPRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQI 172 + V + FPRL ER AG +SGGEQQMLAIGRAL++QP+L+LLDEPSLGL+P +V+ I Sbjct: 128 FDLVYSYFPRLHERRKGLAGYLSGGEQQMLAIGRALIAQPQLILLDEPSLGLSPKLVEDI 187 Query: 173 FQAVKDINREQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYL 232 F + IN E+ ++ +VEQNA AL +AHRGY+M NGK+ + GT L + +VR YL Sbjct: 188 FTIIARINAERGTSMLLVEQNATVALAVAHRGYIMENGKIVIDGTAERLANDPDVREFYL 247 Query: 233 EGG 235 G Sbjct: 248 GMG 250 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 272 Length adjustment: 24 Effective length of query: 212 Effective length of database: 248 Effective search space: 52576 Effective search space used: 52576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory