GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS00885 in Acidovorax sp. GW101-3H11

Align ABC transporter permease (characterized, see rationale)
to candidate Ac3H11_4984 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

Query= uniprot:A0A165KC95
         (309 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4984 High-affinity
           branched-chain amino acid transport system permease
           protein LivH (TC 3.A.1.4.1)
          Length = 296

 Score =  155 bits (393), Expect = 8e-43
 Identities = 99/305 (32%), Positives = 157/305 (51%), Gaps = 19/305 (6%)

Query: 4   LLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPG 63
           L +  + G+  G +YAL AL + MVY   +++N A GE+LM+GA   ++   M   A+P 
Sbjct: 10  LFEISLTGIAGGGLYALAALAFVMVYKATRVVNIAIGELLMVGAYLFFTFASMF--ALP- 66

Query: 64  APGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAMIIW 123
                 L LA   A +    L  +IE+   RPL   P ++  +  +G++ +L  L  +IW
Sbjct: 67  ------LWLAIPAAVLGTGLLGALIERTMIRPLLGEPPISVFMVTVGLASVLVGLVEMIW 120

Query: 124 KPNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRATAEN 183
             + +  P  +P+ P  +G AF+ P       +  V +A+++ +      G A+RATA +
Sbjct: 121 TADQRRLPDFMPTQPIMVGDAFLAPKVFWGAVIAIVFIAAVLVVFRFWRGGVALRATASD 180

Query: 184 PRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAVFGG 243
              A  +G+    V S  ++  A+LAAI+GI+  S  G    +MG   GL      + GG
Sbjct: 181 QAAAYSVGINVPRVFSLAWVASAMLAAISGIIVGS-IGGISSSMGVF-GLSVLVVVIVGG 238

Query: 244 IGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGLLGE 303
           + ++ GA++GGIL+GLIEA        L G  LG  Y  +  FIVL+ +L +RP GL G 
Sbjct: 239 LDSVLGALIGGILIGLIEA--------LAGAYLGGEYKLLATFIVLVAVLLVRPYGLFGT 290

Query: 304 RVADR 308
              +R
Sbjct: 291 HEIER 295


Lambda     K      H
   0.327    0.142    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 215
Number of extensions: 16
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 309
Length of database: 296
Length adjustment: 27
Effective length of query: 282
Effective length of database: 269
Effective search space:    75858
Effective search space used:    75858
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory