Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate Ac3H11_4626 Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)
Query= uniprot:A0A165KC78 (242 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4626 Length = 278 Score = 209 bits (533), Expect = 4e-59 Identities = 112/244 (45%), Positives = 160/244 (65%), Gaps = 7/244 (2%) Query: 5 SNKVLLQVKGLKVAYGGIQAV-KGVDFEVREGELVSLIGSNGAGKTTTMKAITGTL---- 59 S ++L V G++V Y + V KGV +V +G +V+++G NGAGKTTT++AI+ L Sbjct: 12 SKNIVLNVNGIEVIYNHVILVLKGVSLQVPQGSIVAILGGNGAGKTTTLRAISNLLQGER 71 Query: 60 -SMNDGNIEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGI 118 ++ G+IE G+ I+ DLV+ G+V V EGR FA +TI ENL G+Y R KA I Sbjct: 72 GAVTKGSIELRGERIENLSPADLVQRGVVQVMEGRHCFAHLTIEENLMTGSYTRTSKAEI 131 Query: 119 LADIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMV 178 A++EK++ FPRL+ R+ A SGGEQQM A+GRALM+ P ++LLDEPSMGL+P +V Sbjct: 132 AANLEKVYNYFPRLKTRRTSQAAYTSGGEQQMCAIGRALMANPSMVLLDEPSMGLAPQIV 191 Query: 179 DKIFEVVRDVYAL-GVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVRA 237 +++F +V+D+ VT +L EQN + AL +D GY+MESG + M G L N+ V+ Sbjct: 192 EEVFNIVKDLNTKEKVTFLLAEQNTNMALKYSDYGYIMESGRVVMDGAASDLANNEDVKE 251 Query: 238 AYLG 241 YLG Sbjct: 252 FYLG 255 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 278 Length adjustment: 24 Effective length of query: 218 Effective length of database: 254 Effective search space: 55372 Effective search space used: 55372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory