Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate Ac3H11_1610 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= TCDB::P31134 (377 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1610 Length = 362 Score = 253 bits (646), Expect = 6e-72 Identities = 148/357 (41%), Positives = 211/357 (59%), Gaps = 14/357 (3%) Query: 20 LEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLD 79 L++ ++TK Y AV ++L++ KGE +LLG SGCGK+T L+M+AGFE ++G+I L Sbjct: 4 LQLTDVTKFYGSTCAVQSMNLSVEKGEFVSLLGPSGCGKTTTLQMVAGFEAVTSGRIELA 63 Query: 80 GVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHM 139 G D++ R + ++FQSYALFPHMTV N++FGL+ K+PKAE RV + LGLVH+ Sbjct: 64 GRDITHAKANTRGLGIVFQSYALFPHMTVADNVSFGLEMRKVPKAERKDRVAQALGLVHL 123 Query: 140 QEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERV 199 ++ A R P +LSGGQRQRVALAR+L P +LLLDEP+ LD KLR+ MQ E+ I +V Sbjct: 124 EKHAGRYPRELSGGQRQRVALARALVIEPPVLLLDEPLSNLDAKLREEMQFELRQIQRKV 183 Query: 200 GVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGV 259 G T VMVTHDQ EAM+++ R+ +M G+ QI P +YEHP TR+ + F+G N+ G Sbjct: 184 GTTTVMVTHDQSEAMSISDRVVVMEAGRATQIDHPHRVYEHPRTRFISTFVGKANLVPGQ 243 Query: 260 LKERQEDGLVLDSPGLVHPLKVDAD-ASVVDNVPVHVALRPEKIMLCEEPPANGCNFAVG 318 + + + P++V + A V +++RPEK+ L P G G Sbjct: 244 VTTASATHTHVGA----GPIEVRVEGAQFRPGAAVLLSVRPEKLQLV--PTVQG--RIDG 295 Query: 319 EVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWGDEVRLCWEVDSCVVL 375 EV +LG +Y V G ++ A +G G+ L W D C+ L Sbjct: 296 EVCERFFLGSQWLYRVGTGMGDLMVL----APNDGRGALEEGERTGLDWP-DHCMRL 347 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 362 Length adjustment: 30 Effective length of query: 347 Effective length of database: 332 Effective search space: 115204 Effective search space used: 115204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory