Align Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized)
to candidate Ac3H11_2058 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= TCDB::Q97Q42 (385 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2058 Length = 360 Score = 238 bits (608), Expect = 2e-67 Identities = 140/351 (39%), Positives = 207/351 (58%), Gaps = 12/351 (3%) Query: 6 IEFKNVSKVF--EDSNTKVLKDINFELEEGKFYTLLGASGSGKSTILNIIAGLLDATTGD 63 I F+N++K + + S +K I+FE+ G T+LG SG GK+T L +IAGL T+G+ Sbjct: 8 IVFRNITKRYGTDSSAALAVKGISFEVPRGTLTTILGPSGCGKTTTLRMIAGLESPTSGE 67 Query: 64 IMLDGVRINDIPTNKRDVHTVFQSYALFPHMNVFENVAFPLRLRKIDKKEIEQRVAEVLK 123 I + G + + +R+V +FQSYALFPHMNV ENV + LR+ K++ + E L+ Sbjct: 68 IFIGGKDVTTLGPAQRNVSMMFQSYALFPHMNVVENVMYGLRMSGQPKEQARAKAVEALR 127 Query: 124 MVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDEPLSALDLKLRTDMQYELREL 183 V L G++ R +LSGGQ+QRVA+ARA++ +P V+L DEPLS LD +LR +M+ E+R L Sbjct: 128 GVGLVGFDDRLPSELSGGQQQRVALARALVLEPEVLLFDEPLSNLDARLRREMREEIRAL 187 Query: 184 QQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTPVDIYDEPINHFVATFIGESNI 243 QQRL +T +VTHDQ EA+A+SD I VMN G I Q G+P +Y+ P + FVA F+GE+ + Sbjct: 188 QQRLSLTVAYVTHDQAEAMAVSDQIIVMNQGLIAQKGSPRALYETPHSEFVAGFMGEAML 247 Query: 244 LPGTMIEDYLVEFNG---KRFEAVDGGMKPNEPVEVVIRPEDLRITLPEEGKLQVKVDTQ 300 P D V + AV G PV+V +RPE RIT EG L ++ Sbjct: 248 FPAVADADGTVALGPLVLRPRVAVKSG-----PVKVAVRPEAWRITRQGEGLLPARLAKS 302 Query: 301 LFRGVHYEIIAYDELGNEWMIHSTRKAI--VGEEIGLDFEPEDIHIMRLNE 349 + G +E LG+ +++ S + VG+++ L + ++ E Sbjct: 303 AYLGAVHEYTFETALGSIFVVSSDLDDVLAVGDDVQLGLGVHGVSVVGSTE 353 Lambda K H 0.318 0.138 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 360 Length adjustment: 30 Effective length of query: 355 Effective length of database: 330 Effective search space: 117150 Effective search space used: 117150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory