Align putrescine transport system permease protein PotH (characterized)
to candidate Ac3H11_4182 Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)
Query= CharProtDB::CH_088338 (317 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4182 Length = 420 Score = 161 bits (407), Expect = 3e-44 Identities = 82/219 (37%), Positives = 135/219 (61%), Gaps = 1/219 (0%) Query: 83 LGNFLQLTDDPLYFDAYL-QSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVIL 141 LG+ ++ ++ F L ++ ++ + T CLL+GYPLAW +A N+L++LV++ Sbjct: 186 LGHIERMPEEQRAFGGILLRTFHISLVVTLVCLLLGYPLAWWLASLPARPANVLMILVLV 245 Query: 142 PSWTSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVPFMVL 201 P WTS L+RV AW+ +L++ G++N L+ LG+I+QPL +L V I +V+ +PFM+L Sbjct: 246 PFWTSILVRVAAWIVLLQSEGLVNRGLMGLGLIEQPLALLFNRTGVVIAMVHILLPFMIL 305 Query: 202 PIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFVIPEL 261 P+Y+ + + + + AA+ LG+ P+ FF V VP T GI AG +LVFI A+G +V P L Sbjct: 306 PLYSVMKSVPPTYLRAAVSLGSSPMAAFFRVYVPQTYPGIGAGVLLVFILAIGYYVTPAL 365 Query: 262 LGGPDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLLIV 300 LGG D M+ + + +W +A A+ ++L +V Sbjct: 366 LGGADDQMLSYYIARYTNVEVNWGMACALGALLLAATLV 404 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 25 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 420 Length adjustment: 29 Effective length of query: 288 Effective length of database: 391 Effective search space: 112608 Effective search space used: 112608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory