Align small component of D-alanine uptake system, with Psest_0347 (actP-like) (characterized)
to candidate Ac3H11_205 FIG152265: Sodium:solute symporter associated protein
Query= reanno::psRCH2:GFF345 (87 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_205 Length = 99 Score = 58.9 bits (141), Expect = 1e-14 Identities = 26/61 (42%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Query: 24 LVVWALVSYGFGILLRPLVAGIPVGGTDLGFWFAQQGSIITFIAIIFHYAWRLNKLDKEF 83 L++WALVS+G R L A + +GG LG+W A QG+++ FI I+ Y W +N+L++ Sbjct: 22 LLLWALVSFGATYFARDLQA-LVIGGWPLGYWIAAQGAVLVFIGIVVVYGWAMNRLERSD 80 Query: 84 G 84 G Sbjct: 81 G 81 Lambda K H 0.326 0.142 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 47 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 87 Length of database: 99 Length adjustment: 10 Effective length of query: 77 Effective length of database: 89 Effective search space: 6853 Effective search space used: 6853 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.2 bits) S2: 39 (19.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory