Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate Ac3H11_2774 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= metacyc::MONOMER-16231 (254 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2774 Length = 276 Score = 134 bits (336), Expect = 3e-36 Identities = 89/252 (35%), Positives = 142/252 (56%), Gaps = 11/252 (4%) Query: 4 LEGKTVLVTGASTGIGRAAAIGAAQHGADVAINYAHSDGPAQSCVAEIEALGQRAIAVKG 63 L+GK +VTGA G+G A A+HGA VA+ + +G AQS AEI+A G +A+A++ Sbjct: 6 LDGKVAIVTGAGAGLGAECARSLARHGARVAVVDINLEG-AQSVAAEIKAGGGKALAIQT 64 Query: 64 DVADPQTAQDFVAKAVETFGKVDVMVSNAG-ICPFHAFLDMPVDVVE-----RTFKVNLH 117 D+ + V+ ++ FG++DV+ +NA + P D V V+ R VN Sbjct: 65 DLTSEEGVAAMVSAVLDHFGRIDVLHNNAAALDPAQRAGDRDVCNVDLSAWDRAMNVNAR 124 Query: 118 GAYFMVQAAAQQMVRQGHGGSIVAVSSISALVGGEYQTHYTPTKAGVHSLMQSTAIALGK 177 GA + A M++ G GGSI+ +S L+G T Y +KA + +L +S A GK Sbjct: 125 GAMLCCKHAIPHMLKVG-GGSIIFATSGFGLLGDATLTAYAASKAALMALARSVAAQYGK 183 Query: 178 HGIRCNSVLPGTILTEINKDDLADQEKREYMEAR-TPLGRLGAPEDLAGPIVFLASDMAA 236 GIR N+++ G +L E + + + K+ ++ TP +LG+P+ +A + FLASD ++ Sbjct: 184 EGIRSNAIMIGFVLNEHAQKGVPQEIKQILLDQHLTP--QLGSPKQIADVVSFLASDESS 241 Query: 237 YVTGAALLVDGG 248 ++TGA + VDGG Sbjct: 242 FITGAVIPVDGG 253 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 276 Length adjustment: 25 Effective length of query: 229 Effective length of database: 251 Effective search space: 57479 Effective search space used: 57479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory