Align RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate Ac3H11_2880 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)
Query= TCDB::Q7BSH3 (333 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2880 Length = 350 Score = 171 bits (434), Expect = 2e-47 Identities = 109/305 (35%), Positives = 171/305 (56%), Gaps = 9/305 (2%) Query: 16 IVVMIVVFSTRAADFATPGNLAGIFNDTSILIILALAQMTVILTKSIDLSVAANLAF-TG 74 +V++ + + ++FAT N+ + T+ + I+A+ VI++ IDLSV + A G Sbjct: 47 LVLLCIAGTLLNSNFATYDNVMNVLTRTAFIGIIAVGMCFVIISGGIDLSVGSMAALIAG 106 Query: 75 MAIAMMNAAHPDL-----PLVVLILMAVVIGACLGAINGFLVWALEIPPIVVTLGTLTIY 129 I MNA P L +VV +L+AVV+GA G ++G L+ I P +VTLGTL I+ Sbjct: 107 SVILFMNAMAPVLGSPMAAVVVGMLLAVVLGAVFGLVHGLLITKGRIEPFIVTLGTLGIF 166 Query: 130 RG-MAFVLSGGAWVNAHQMTPIFLSVPRTPVLGLPVLSWVGIIIVILMYVLLRYTQFGRS 188 R + + +GGA + ++ I+ V +LG+P+ W+ +++ I+ V+L T +GR Sbjct: 167 RAYLTYFSNGGAITLENDLSDIYSPVYYANLLGVPIPVWIFLLVAIVGGVILNRTAYGRY 226 Query: 189 AYATGGNPTAAVYAGIDTGWTKFLAFVLSGALAGLASYLWVSRYAVAYVDIANGFELDSV 248 A G N A YA +D K L ++L G G+A+ L+V R A +EL+++ Sbjct: 227 VQAIGSNEQVAQYAAVDVHKIKILTYMLLGVCVGIATLLYVPRLGSASPTTGLLWELEAI 286 Query: 249 AACVIGGISIAGGVGSVAGTVLGALFLGVIKNALPVIG-ISPFTQMAISGTVIILAVAFN 307 AA ++GG + GG GS+ GTV+GA+ L VI N L + IS + A+ G VII AVAF Sbjct: 287 AAVIVGGTVLKGGAGSITGTVVGAILLSVISNILNLTSIISVYLNAAVQGFVII-AVAFM 345 Query: 308 ARRER 312 R +R Sbjct: 346 QRGKR 350 Lambda K H 0.328 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 350 Length adjustment: 29 Effective length of query: 304 Effective length of database: 321 Effective search space: 97584 Effective search space used: 97584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory