Align deoxyribose kinase (EC 2.7.1.15) (characterized)
to candidate Ac3H11_700 2-dehydro-3-deoxygluconate kinase (EC 2.7.1.45)
Query= reanno::Burk376:H281DRAFT_01116 (320 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_700 Length = 319 Score = 109 bits (272), Expect = 1e-28 Identities = 91/295 (30%), Positives = 129/295 (43%), Gaps = 30/295 (10%) Query: 40 FAMGPGGKGSNQAVAAARAGAEVVFCTRIGNDAFGSIAQATWAREGITARASVVEGVSTG 99 + G GG SN +AAARAGA + TR+G+DAFG WAREG+ A + Sbjct: 31 YLQGFGGDTSNAVIAAARAGARTAYLTRLGSDAFGQALLDLWAREGVDTTAVERDAQHPT 90 Query: 100 AAHIFVDDTTGMNAIIVAAGAAGT------LSAADVDAIEADIAGSRVF-VTQLEQPLAA 152 + G + AG+A + L+ V A + R+ V+ + ++A Sbjct: 91 GIYFVTHGAAGHEFSYLRAGSAASRMAPAWLADESVKGPAAVLQQCRILHVSGISLAVSA 150 Query: 153 -----ARRGLEVARKHGVTTVFNP---------APALPLDDDIFPLCDYITPNETEAAAL 198 A + VAR G F+P A A LCD P + AAL Sbjct: 151 SACDTAYEAMRVARAAGARVAFDPNLRLKLWPLARARACIAHAVSLCDIFLPGLDDMAAL 210 Query: 199 TGVPIANVDDARRAADVLLAKGVGTVIVTLGEGGALLHDATQSI---WLPAFRCGAVVET 255 G + DA AD A+G TV+V LG G LL A ++ +P R A+V+ Sbjct: 211 LG-----LSDADAIADWGHAQGAATVVVKLGADGVLLSSADPAVPRQRVPG-RSVALVDA 264 Query: 256 AGAGDGFTGGFAAALARGEDAISAMRFGCALAGISVTRAGTAPSMPTLAEVNRVL 310 GAGD F G A LA G+D +A+R+ A ++V G +PT +V +L Sbjct: 265 TGAGDCFDGNLLARLALGDDLAAAVRYANTAASLAVQGFGAVAPLPTAQQVQALL 319 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 319 Length adjustment: 28 Effective length of query: 292 Effective length of database: 291 Effective search space: 84972 Effective search space used: 84972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory