Align ABC transporter permease (characterized, see rationale)
to candidate Ac3H11_4984 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)
Query= uniprot:A0A165KC95 (309 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4984 Length = 296 Score = 155 bits (393), Expect = 8e-43 Identities = 99/305 (32%), Positives = 157/305 (51%), Gaps = 19/305 (6%) Query: 4 LLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPG 63 L + + G+ G +YAL AL + MVY +++N A GE+LM+GA ++ M A+P Sbjct: 10 LFEISLTGIAGGGLYALAALAFVMVYKATRVVNIAIGELLMVGAYLFFTFASMF--ALP- 66 Query: 64 APGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAMIIW 123 L LA A + L +IE+ RPL P ++ + +G++ +L L +IW Sbjct: 67 ------LWLAIPAAVLGTGLLGALIERTMIRPLLGEPPISVFMVTVGLASVLVGLVEMIW 120 Query: 124 KPNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRATAEN 183 + + P +P+ P +G AF+ P + V +A+++ + G A+RATA + Sbjct: 121 TADQRRLPDFMPTQPIMVGDAFLAPKVFWGAVIAIVFIAAVLVVFRFWRGGVALRATASD 180 Query: 184 PRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAVFGG 243 A +G+ V S ++ A+LAAI+GI+ S G +MG GL + GG Sbjct: 181 QAAAYSVGINVPRVFSLAWVASAMLAAISGIIVGS-IGGISSSMGVF-GLSVLVVVIVGG 238 Query: 244 IGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGLLGE 303 + ++ GA++GGIL+GLIEA L G LG Y + FIVL+ +L +RP GL G Sbjct: 239 LDSVLGALIGGILIGLIEA--------LAGAYLGGEYKLLATFIVLVAVLLVRPYGLFGT 290 Query: 304 RVADR 308 +R Sbjct: 291 HEIER 295 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 296 Length adjustment: 27 Effective length of query: 282 Effective length of database: 269 Effective search space: 75858 Effective search space used: 75858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory