Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate Ac3H11_148 3-hydroxybutyrate dehydrogenase (EC 1.1.1.30)
Query= reanno::Phaeo:GFF1301 (257 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_148 Length = 260 Score = 156 bits (394), Expect = 5e-43 Identities = 100/265 (37%), Positives = 138/265 (52%), Gaps = 29/265 (10%) Query: 4 LSGKRALITGAARGIGAAFAEAYANEGARVVIADIDTARAEATAAQI---GAAAIAVELD 60 LSG+ A ITGA+ G+GA FA A GA VV+A + + A+I G A +ELD Sbjct: 7 LSGRVAFITGASSGLGAQFARTLARAGAGVVLASRRIEKLKELRARIEGEGGDAHVIELD 66 Query: 61 VTDQASIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGTLFMMQ 120 VTD ASI A++ G +DILINN+ V T L +VT E Y FD NV G F+ Q Sbjct: 67 VTDHASIKSAVAHAETEMGSIDILINNSGVSTTQRLQDVTPEDYDFIFDTNVKGAFFVAQ 126 Query: 121 AAAQQMITQG--------TGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLI 172 ++M+ + TGG+IIN+AS AG + P + YC +KAAV+ +T++ + Sbjct: 127 EVGKRMLARSRGAAPGSFTGGRIINIASMAGLKVLPQIGAYCMSKAAVVQMTRAMAMEWG 186 Query: 173 SHGINVNAIAPGVVDGE----HWDGVDAFFAKYEGKAPGQKKAEVAQSVPYGRMGTAADL 228 GIN NAI PG +D E HWD GQK + +P R+G+ DL Sbjct: 187 KFGINTNAICPGYIDTEINHHHWD-----------TEQGQK---LIAMLPRKRVGSPQDL 232 Query: 229 TGMAVFLASEDADYVVAQTYNVDGG 253 + V LAS+ + ++ D G Sbjct: 233 DALLVMLASDQSHFINGAVIAADDG 257 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 260 Length adjustment: 24 Effective length of query: 233 Effective length of database: 236 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory