Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate Ac3H11_2774 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= reanno::Koxy:BWI76_RS22230 (259 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2774 Length = 276 Score = 105 bits (262), Expect = 1e-27 Identities = 85/259 (32%), Positives = 129/259 (49%), Gaps = 20/259 (7%) Query: 3 QVAVVIGGGQTLGEFLCRGLAAEGYRVAVVDIQSDKATRVAQSINAEYGEGTAWGFGADA 62 +VA+V G G LG R LA G RVAVVDI + A VA I A G G A D Sbjct: 9 KVAIVTGAGAGLGAECARSLARHGARVAVVDINLEGAQSVAAEIKA--GGGKALAIQTDL 66 Query: 63 TSEASVVALARGVDDIFSRVDLLVYSAGIAKAA------FISDFALGDFDRSLQVNLVGY 116 TSE V A+ V D F R+D+L +A A + + L +DR++ VN G Sbjct: 67 TSEEGVAAMVSAVLDHFGRIDVLHNNAAALDPAQRAGDRDVCNVDLSAWDRAMNVNARGA 126 Query: 117 FLCAREFSRLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYG 176 LC + M++ G G II S G +G + Y+A+K + L +S+A + G Sbjct: 127 MLCCKHAIPHMLKVG-GGSIIFATSGFGLLGDATLTAYAASKAALMALARSVAAQYGKEG 185 Query: 177 ITVHSLMLGNLLKSPMFQSLLPQYATKLGIPEEQVEQYYIDKVPLKRGCDYQDVLNVLMF 236 I +++M+G +L ++A K G+P+E ++Q +D+ + + + +V+ F Sbjct: 186 IRSNAIMIGFVLN---------EHAQK-GVPQE-IKQILLDQHLTPQLGSPKQIADVVSF 234 Query: 237 YASPQASYCTGQSINVTGG 255 AS ++S+ TG I V GG Sbjct: 235 LASDESSFITGAVIPVDGG 253 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 276 Length adjustment: 25 Effective length of query: 234 Effective length of database: 251 Effective search space: 58734 Effective search space used: 58734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory