Align sorbitol-6-phosphate dehydrogenase (characterized)
to candidate Ac3H11_3127 Oxidoreductase, short chain dehydrogenase/reductase family
Query= CharProtDB::CH_091826 (259 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3127 Length = 302 Score = 89.0 bits (219), Expect = 1e-22 Identities = 71/220 (32%), Positives = 108/220 (49%), Gaps = 15/220 (6%) Query: 3 QVAVVIGGGQTLGAFLCEGLAQAGYHVAVADLNE---------SNANRLADTINSRYGAG 53 +VA+V G G LG LA+ G V V DL S A + D I + G Sbjct: 8 RVAIVTGAGGGLGRQHALALAKRGAKVLVNDLGGAVDGSGATVSAAQAVVDEIRAAGGEA 67 Query: 54 RAYGFKVDATDEASVEALARAVDETFGRADLLVYSAGVAKAAPITQFRLTDFDLSLQVNL 113 A G V TD A+VEA+ + + +GR D+LV +AG+ + + + DF+L +QV+L Sbjct: 68 LANGASV--TDFAAVEAMVQQAIDAWGRVDILVNNAGILRDKSFAKMDMADFNLVVQVHL 125 Query: 114 VGYFLCSREFSKLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLA 173 +G C + M+ GRI+ S +G G+ + Y AAK VGL Q+L+++ A Sbjct: 126 MGAAHCCKAVWPHMVAQQY-GRIVMTTSSTGLYGNFGQANYGAAKLAQVGLMQTLSIEGA 184 Query: 174 EYGITVHSLMLGNLLKSPMFQSLLPQYAEKLGITPEEVEP 213 + I V++ L + M + L+PQ + PE V P Sbjct: 185 KNNIHVNA--LAPTAATRMTEGLMPQEVLD-ALKPEAVVP 221 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 302 Length adjustment: 26 Effective length of query: 233 Effective length of database: 276 Effective search space: 64308 Effective search space used: 64308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory