Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate Ac3H11_1227 TRAP-type C4-dicarboxylate transport system, periplasmic component
Query= SwissProt::P37735 (333 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1227 Length = 334 Score = 195 bits (495), Expect = 2e-54 Identities = 122/326 (37%), Positives = 185/326 (56%), Gaps = 10/326 (3%) Query: 13 ATALSLALSVPAL-AEPIVIKFSHVVAPDTPKGKGAAKFEELAEKYTNGAVDVEVYPNSQ 71 ATAL A +PA A+ IKF+ D P+ +GA KF +L T G + V+++P Sbjct: 9 ATALVAASLLPAAHAQERTIKFAFQNQKDHPQAQGAQKFADLVAAKTGGRIAVKLFPGGT 68 Query: 72 LYKDKEELEALQLGAVQMLAPSLAKFGPLGVQ--DFEVFDLPYIFKDYEALHKVTQGEAG 129 L D + + ALQ G V+M ++ G L Q +F ++D P++F + VT G G Sbjct: 69 LGGDLQTVSALQGGTVEM---TVLNAGILAAQSKEFGIYDFPFLFATPQEADAVTDGPFG 125 Query: 130 KMLLSKLEAKGITGLAFWDNGFK-IMSANTPLTMPDDFLGLKMRIQSSKVLEAEMNALGA 188 K LL KL+AK + GL +W+ GF+ + ++ P+T +D GLK+R+ S + NALGA Sbjct: 126 KKLLDKLQAKNLVGLGYWELGFRNLTNSKKPITKAEDIAGLKIRVIQSPIYIDLFNALGA 185 Query: 189 VPQVMAFSEVYQALQTGVVDGTENPPSNMFTQKMNEVQKHATVSNHGYLGYAVIVNKQFW 248 M F E+Y A++ VDG ENP S + + K EVQK+ TV+ H Y AVIV+K+FW Sbjct: 186 NAVPMPFPELYTAMEQKAVDGQENPFSTILSSKFAEVQKYLTVTRHMYNPQAVIVSKKFW 245 Query: 249 DGL-PADVRTGLEKAMAESTDYANGIAKEENEKALQAMKDAGTTEFHELTAEERAAWEEV 307 D L PAD + L AMAE+T + G+++ + AL+ +K AG + E + E Sbjct: 246 DSLNPAD-QKALTDAMAEATTFQRGVSRVQANVALEDLKKAG-MQVSEFSPAELDKLRAK 303 Query: 308 LTPVHDEMAERIGAETIAAVKAATAE 333 + PV ++ +E++GAET+ V + A+ Sbjct: 304 VKPVVEKHSEKVGAETVQEVYSTLAK 329 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 334 Length adjustment: 28 Effective length of query: 305 Effective length of database: 306 Effective search space: 93330 Effective search space used: 93330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory