Align ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized)
to candidate Ac3H11_2065 Maltose/maltodextrin ABC transporter, permease protein MalG
Query= reanno::Smeli:SMc03063 (380 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2065 Length = 289 Score = 119 bits (298), Expect = 1e-31 Identities = 75/220 (34%), Positives = 119/220 (54%), Gaps = 9/220 (4%) Query: 162 GIGRSFLNSLTVAVPSTVIPILIAAFAAYALAWMPFPGRAVLLAVVVGLLVVPLQMSLIP 221 G+ F+NS+ +AVP+ +I + A Y L+ F G L +++ + +P Q+ L+P Sbjct: 77 GLRPFFMNSVAMAVPAVLISTVWGALNGYVLSLWKFRGSDALFGMLLFGVFMPFQVVLLP 136 Query: 222 LLQLYNGVGAFFGVSAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVDGASD 281 + Q+ +G ++ G+ L H GL RNY A +P+E++ +AR+DGAS Sbjct: 137 MSQVLGWLGLSSSIT-----GLVLVHCLAGLAGTTLFFRNYYAAIPKELVNAARMDGASF 191 Query: 282 FDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGDDKLVLTGRLVNLLGSRGG 341 F IF +I+LPLS P + I+QF WND L +VF G D K V G L NL + Sbjct: 192 FQIFWRIVLPLSTPIVMVTLIWQFTNIWNDFLFGVVFSGT-DSKPVTVG-LNNLANTSSS 249 Query: 342 --NWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKG 379 + + A+A I + ++++ ++ VRGL AG+VKG Sbjct: 250 VKAYNVDMAAAIIAGLPTMVIYVLAGKFFVRGLTAGAVKG 289 Lambda K H 0.324 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 289 Length adjustment: 28 Effective length of query: 352 Effective length of database: 261 Effective search space: 91872 Effective search space used: 91872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory