Align Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 (characterized)
to candidate Ac3H11_658 Fructose-bisphosphate aldolase class II (EC 4.1.2.13)
Query= SwissProt::Q56815 (354 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_658 Length = 349 Score = 488 bits (1256), Expect = e-142 Identities = 243/349 (69%), Positives = 287/349 (82%) Query: 6 MRQLLDHAADDSYGLPAFNVNNMEQVKAIMDAARATSSPVILQGSAGARKYAGEPFLRHL 65 MR+LLDHAA +SYG+PAFNVNN+EQV+A+M AA +PVILQ SAGARKYAGEPF++HL Sbjct: 1 MRELLDHAAANSYGIPAFNVNNLEQVQAVMAAADEVGAPVILQASAGARKYAGEPFIKHL 60 Query: 66 IAAAVEAYPEIPVVMHQDHGASPAVCMGAIKSGFSSVMMDGSLKEDGKTPADYDYNVSVT 125 I AAVEA+P IP+VMHQDHG SP VC GAI GF SVMMDGSL EDGKTP+ ++YNV VT Sbjct: 61 IQAAVEAFPHIPLVMHQDHGTSPKVCAGAIDLGFGSVMMDGSLMEDGKTPSSFEYNVEVT 120 Query: 126 AKVVELAHAVGVSVEGELGCLGSLETGKGEAEDGHGAEEALDHSKLLTDPDEAAQFVKAT 185 KVV++AH VGV+VEGELGCLG+LETG+ EDG GA+ LDHS++LTDP+EAA FVKAT Sbjct: 121 RKVVDMAHKVGVTVEGELGCLGNLETGEAGEEDGIGADVKLDHSQMLTDPEEAAVFVKAT 180 Query: 186 QCDALAIAIGTSHGAYKFTRKPTGDILAIDRIKAIHQRIPTTHLVMHGSSSVPQELLEEI 245 Q DALAIAIGTSHGAYKF+RKPTGDILAI R+K IH+RIP THLVMHGSSSVP ELL I Sbjct: 181 QLDALAIAIGTSHGAYKFSRKPTGDILAISRVKEIHKRIPNTHLVMHGSSSVPAELLAII 240 Query: 246 RTYGGDIKETYGVPVEEIQEGIRYGVRKVNIDTDIRLAMTAAIRRVGAKNKSEFDPRKFM 305 YGG +KETYGVPVEEIQE I++GVRK+NIDTDIRLAMT A+R+ A+N +FD R+++ Sbjct: 241 NQYGGKMKETYGVPVEEIQEAIKHGVRKINIDTDIRLAMTGAVRKFLAENPDKFDAREWL 300 Query: 306 AAAMEEAKKVCIARFEAFGSAGKAEKIRAIELDEMAKRYASGELAQVVH 354 A E AK+VC AR+ FG G+ KI+ L +A +YASG LAQVV+ Sbjct: 301 KPAREAAKQVCKARYLEFGCEGQGAKIKGHSLQVVAAQYASGALAQVVN 349 Lambda K H 0.316 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 349 Length adjustment: 29 Effective length of query: 325 Effective length of database: 320 Effective search space: 104000 Effective search space used: 104000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Ac3H11_658 (Fructose-bisphosphate aldolase class II (EC 4.1.2.13))
to HMM TIGR01521 (fba: fructose-bisphosphate aldolase, class II, Calvin cycle subtype (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01521.hmm # target sequence database: /tmp/gapView.17467.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01521 [M=347] Accession: TIGR01521 Description: FruBisAldo_II_B: fructose-bisphosphate aldolase, class II, Calvin cycle subtype Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-179 581.5 1.3 3.3e-179 581.3 1.3 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_658 Fructose-bisphosphate aldolase c Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_658 Fructose-bisphosphate aldolase class II (EC 4.1.2.13) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 581.3 1.3 3.3e-179 3.3e-179 4 347 .] 1 344 [. 1 344 [. 1.00 Alignments for each domain: == domain 1 score: 581.3 bits; conditional E-value: 3.3e-179 TIGR01521 4 lrqlldhaaergygvpafnvnnleqilaimeaadktdspvilqasrgarsyagevllrklvla 66 +r lldhaa ++yg+pafnvnnleq+ a+m aad+ +pvilqas+gar+yage+++++l++a lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_658 1 MRELLDHAAANSYGIPAFNVNNLEQVQAVMAAADEVGAPVILQASAGARKYAGEPFIKHLIQA 63 8************************************************************** PP TIGR01521 67 aveeypdipvvlhqdhgnspatclsaiqlgftsvmmdgslkedaktpadydynvsvtaevvkl 129 ave +p+ip+v+hqdhg+sp++c ai lgf svmmdgsl ed+ktp++++ynv+vt +vv + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_658 64 AVEAFPHIPLVMHQDHGTSPKVCAGAIDLGFGSVMMDGSLMEDGKTPSSFEYNVEVTRKVVDM 126 *************************************************************** PP TIGR01521 130 ahavgasvegelgclgsletgkgeaedghgfegaldrsqlltdpeeaaefvkktkvdalavai 192 ah vg++vegelgclg letg++++edg g++ +ld+sq+ltdpeeaa fvk t++dala+ai lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_658 127 AHKVGVTVEGELGCLGNLETGEAGEEDGIGADVKLDHSQMLTDPEEAAVFVKATQLDALAIAI 189 *************************************************************** PP TIGR01521 193 gtshgaykftrkptgevlaidrieeiherlpdthlvmhgsssvpqewldvineyggeiketyg 255 gtshgaykf+rkptg++lai+r++eih+r+p+thlvmhgsssvp e l++in+ygg++ketyg lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_658 190 GTSHGAYKFSRKPTGDILAISRVKEIHKRIPNTHLVMHGSSSVPAELLAIINQYGGKMKETYG 252 *************************************************************** PP TIGR01521 256 vpveeivkgikfgvrkvnidtdlrlaataalrrvaakdpsefdprkflkkaveamkdvckary 318 vpveei++ ik+gvrk+nidtd rla+t+a+r+++a++p++fd r++lk+a ea k+vckary lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_658 253 VPVEEIQEAIKHGVRKINIDTDIRLAMTGAVRKFLAENPDKFDAREWLKPAREAAKQVCKARY 315 *************************************************************** PP TIGR01521 319 eafgtagnaskikvvsleemarryakgel 347 +fg g+ +kik sl+ +a++ya+g l lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_658 316 LEFGCEGQGAKIKGHSLQVVAAQYASGAL 344 **************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (347 nodes) Target sequences: 1 (349 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.73 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory