Align ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale)
to candidate Ac3H11_607 Predicted L-arabinose ABC transport system, ATP-binding protein
Query= uniprot:A0A0C4Y5F6 (540 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_607 Length = 517 Score = 358 bits (919), Expect = e-103 Identities = 213/511 (41%), Positives = 316/511 (61%), Gaps = 23/511 (4%) Query: 11 APLLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILSGAYTADPGGE 70 AP+L L I K F G+ LR V+L Y GE+HALMG+NGAGKSTL+K+L+G A GG+ Sbjct: 16 APVLQLSGIHKQFAGITVLRDVQLNLYPGEIHALMGQNGAGKSTLIKVLTGVLEAS-GGQ 74 Query: 71 CHIDGQRVQIDGPQSARDLGVAVIYQELSLAPNLSVAENIYLGRALQRRGLVARGDMV-- 128 + GQ V D P +A+ LG++ +YQE++L PNLSVAENI+ GR R +A+G + Sbjct: 75 MRLGGQAVWPDSPLAAQRLGISTVYQEVNLCPNLSVAENIFAGR--YPRCGIAQGFRIDW 132 Query: 129 ----RACAPTLARLGADFSPAANVASLSIAQRQLVEIARAVHFEARILVMDEPTTPLSTH 184 + +AR+G ++ +A +QLV IARA+ E+R+L++DEPT+ L Sbjct: 133 ATLHQRARDLVARIGLQIDVTRLLSDYPVAVQQLVAIARALSIESRVLILDEPTSSLDDD 192 Query: 185 ETDRLFALIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQAALVK 244 E +LF ++R+LR EG++I++++H + ++ ++DR+TVLR+G +VG L AL+ Sbjct: 193 EVQKLFEVLRRLRSEGLSIVFVTHFLNQVYAVSDRITVLRNGSWVGEWLAKDLGPQALIA 252 Query: 245 MMVGRDLSGFYTK-THGQAVEREV--MLSVRDVADGRRVKGCSFDLRAGEVLGLAGLVGA 301 M+GRDL+ + AV+ +L + +++ +RAGEV+GLAGL+G+ Sbjct: 253 AMLGRDLAAASEQPAPAPAVDSRHANLLQAEGLGQDTQLQPLDLQIRAGEVVGLAGLLGS 312 Query: 302 GRTELARLVFGADARTRGEVRIANPAGSGGLVTLPAGGPRQAIDAGIAYLTEDRKLQGLF 361 GRTELARL+FG + RG +RI G +V P AI G+A E+RK G+ Sbjct: 313 GRTELARLLFGLEQPDRGALRI-----DGQVVKF--ANPMDAIRHGLALCPEERKTDGIV 365 Query: 362 LDQSVHENINLIVAARDALGLGR-LNRTAARRRTTEAIDTLGIRVAHAQVNVGALSGGNQ 420 + SV ENI L + AR +G+G+ L+R+ + LGI+ +G LSGGNQ Sbjct: 366 AELSVRENIALALQAR--MGVGKFLSRSEQTELAERYVKLLGIKTETVDKPIGLLSGGNQ 423 Query: 421 QKVMLSRLLEIQPRVLILDEPTRGVDIGAKSEIYRLINALAQSGVAILMISSELPEVVGL 480 QK +L+R + I+PR+LILDEPTRG+D+ AK EI I LAQ+G+A+L ISSE+ EVV + Sbjct: 424 QKAILARWMAIEPRLLILDEPTRGIDVAAKQEIMDQILRLAQAGMAVLFISSEMSEVVRV 483 Query: 481 CDRVLVMREGTLAGEVRPAGSAAETQERIIA 511 R++V+R+ GE+ PAGS+ + +IA Sbjct: 484 AHRIVVLRDRRKVGEL-PAGSSEDAVYDLIA 513 Lambda K H 0.320 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 678 Number of extensions: 35 Number of successful extensions: 10 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 540 Length of database: 517 Length adjustment: 35 Effective length of query: 505 Effective length of database: 482 Effective search space: 243410 Effective search space used: 243410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory