Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate Ac3H11_1841 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1841 Length = 892 Score = 200 bits (508), Expect = 1e-55 Identities = 136/332 (40%), Positives = 191/332 (57%), Gaps = 15/332 (4%) Query: 6 TRPAASTGAPLPAGTL-GRLTTQERLRALGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQ 64 T PAA P A +L T LG+L VL + FS L+E F + IA Sbjct: 567 TAPAAPAATPSSASVWRSQLGTY-----LGLLAVLAGMVALFSSLSEYFWSAETFITIAN 621 Query: 65 QASINMVLAAGMTFVILTGGIDLSVGSILSISAVVAMLVSLMPQLGMLSVPAA----LLC 120 + V+A GMTFV++ GIDLSVGS+++++A + L Q G +VPAA L Sbjct: 622 EIPALAVMAVGMTFVLIIAGIDLSVGSVMALAAATSAAAIL--QWGW-TVPAAAALALAT 678 Query: 121 GLLFGIVNGALVAFMKLPPFIVTLGTLTAVRGLARLVGNDSTIYNPDIGFAFIGNGEVLG 180 GL+ G + GA+ +LP FIV+LG L AVRG A +V + T Y D +++ G Sbjct: 679 GLVCGTITGAISVAWRLPSFIVSLGMLEAVRGSAYVVTDSRTQYVGD-AISWLSAPFFGG 737 Query: 181 VPWLVIIAFAVVAVSWFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLA 240 + + ++A +V V+ VL RTV G + +G N EA RL+G+ + + V+A++GLLA Sbjct: 738 ISFAFLLAVVLVVVAQLVLSRTVFGRCVVGIGTNEEAMRLAGVDPRPIRVIVFAMTGLLA 797 Query: 241 GLGGVMSSARLYAANGLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSN 300 GL G+M SARL AA+ G EL IAAV++GGTS +GG GS+V T G LIIAVL Sbjct: 798 GLAGLMQSARLEAADP-NAGTGMELQVIAAVVIGGTSLMGGRGSVVNTAFGVLIIAVLEA 856 Query: 301 GLVLLGVSDIWQYIIKGLVIIGAVALDSYRRK 332 GL +G S+ + II G VI+ AV +D+ R++ Sbjct: 857 GLAQVGASEPSKRIITGFVIVAAVIVDTLRQR 888 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 672 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 892 Length adjustment: 35 Effective length of query: 302 Effective length of database: 857 Effective search space: 258814 Effective search space used: 258814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory