Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate Ac3H11_3541 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)
Query= BRENDA::Q8PK83 (297 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3541 Length = 295 Score = 306 bits (783), Expect = 5e-88 Identities = 161/285 (56%), Positives = 198/285 (69%), Gaps = 2/285 (0%) Query: 5 IRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHS 64 +RKAVFPVAGLGTRFLPATK PKEMLP++DKPLIQYAV+EA AG +IFVT R K + Sbjct: 7 VRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRSKRA 66 Query: 65 IADYFDKAYELEQKLERAGKLEQLELVRHALPDGVRAIFVTQAEALGLGHAVLCAKAVVG 124 I D+FD AYELE +LE A K E L LVR PD + FV Q +LGLGHAVLCA+ +VG Sbjct: 67 IEDHFDTAYELEAELEAANKKELLALVRSIQPDDMDCAFVRQPRSLGLGHAVLCAEPLVG 126 Query: 125 NEPFAVLLPDDLMWN--RGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDAFD 182 EPFAVLL DDLM G L QMA+ G SVIAV++VP D+ YGIV+ + Sbjct: 127 KEPFAVLLADDLMVGPPGGQPVLAQMASAFRQQGRSVIAVQEVPEDQVHKYGIVAGEPAG 186 Query: 183 GRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAELLK 242 G RI IVEKPK +VAPS + V GRY+L+P +FD + G GGEIQLTD IA L++ Sbjct: 187 GPLIRIERIVEKPKADVAPSRMGVAGRYILTPGVFDEIRNQPRGVGGEIQLTDGIARLMQ 246 Query: 243 EEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILR 287 E V AF+++G+R+DCG+ G +EATV AL+H + G +E L+ Sbjct: 247 HEAVYAFQYQGKRYDCGSKEGFLEATVELALQHPQVGAHFREYLK 291 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 295 Length adjustment: 26 Effective length of query: 271 Effective length of database: 269 Effective search space: 72899 Effective search space used: 72899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_3541 (UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.29801.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-113 362.5 0.0 8.2e-113 362.3 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 UTP--glucose-1-phosphate uridyly Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 362.3 0.0 8.2e-113 8.2e-113 1 261 [] 7 271 .. 7 271 .. 0.98 Alignments for each domain: == domain 1 score: 362.3 bits; conditional E-value: 8.2e-113 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraie 62 +rkav+P+aGlGtr+LPatka Pkemlp+vdkPliqy+veea +aGi ++++vtgrskraie lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 7 VRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRSKRAIE 68 79************************************************************ PP TIGR01099 63 dhfDtsyeleaklekknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepf 123 dhfDt+yelea+le +nk+ell vr+i++ +++ +vrq + GLGhavl+ae+lvg+epf lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 69 DHFDTAYELEAELEAANKKELLALVRSIQPDdMDCAFVRQPRSLGLGHAVLCAEPLVGKEPF 130 *****************************988****************************** PP TIGR01099 124 avllgDdlvseeee...alkqlielyektgasiiaveevpkeevskYGvidgeeveeelyev 182 avll+Ddl++ +l+q+ +++++ g s+iav+evp+++v+kYG+++ge l+++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 131 AVLLADDLMVGPPGgqpVLAQMASAFRQQGRSVIAVQEVPEDQVHKYGIVAGEPAGGPLIRI 192 *********98654555********************************************* PP TIGR01099 183 kdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkggeiqltDalrlllekeevlavk 244 + +vekPk++ aps + + GrY+ltp +f+ ++++++G+ggeiqltD+++ l+++e+v+a++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 193 ERIVEKPKADVAPSRMGVAGRYILTPGVFDEIRNQPRGVGGEIQLTDGIARLMQHEAVYAFQ 254 ************************************************************** PP TIGR01099 245 lkgkryDvGdklgylka 261 +gkryD+G+k+g+l+a lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 255 YQGKRYDCGSKEGFLEA 271 ***************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.36 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory