Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate Ac3H11_3541 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)
Query= BRENDA::Q8PK83 (297 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3541 Length = 295 Score = 306 bits (783), Expect = 5e-88 Identities = 161/285 (56%), Positives = 198/285 (69%), Gaps = 2/285 (0%) Query: 5 IRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHS 64 +RKAVFPVAGLGTRFLPATK PKEMLP++DKPLIQYAV+EA AG +IFVT R K + Sbjct: 7 VRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRSKRA 66 Query: 65 IADYFDKAYELEQKLERAGKLEQLELVRHALPDGVRAIFVTQAEALGLGHAVLCAKAVVG 124 I D+FD AYELE +LE A K E L LVR PD + FV Q +LGLGHAVLCA+ +VG Sbjct: 67 IEDHFDTAYELEAELEAANKKELLALVRSIQPDDMDCAFVRQPRSLGLGHAVLCAEPLVG 126 Query: 125 NEPFAVLLPDDLMWN--RGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDAFD 182 EPFAVLL DDLM G L QMA+ G SVIAV++VP D+ YGIV+ + Sbjct: 127 KEPFAVLLADDLMVGPPGGQPVLAQMASAFRQQGRSVIAVQEVPEDQVHKYGIVAGEPAG 186 Query: 183 GRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAELLK 242 G RI IVEKPK +VAPS + V GRY+L+P +FD + G GGEIQLTD IA L++ Sbjct: 187 GPLIRIERIVEKPKADVAPSRMGVAGRYILTPGVFDEIRNQPRGVGGEIQLTDGIARLMQ 246 Query: 243 EEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILR 287 E V AF+++G+R+DCG+ G +EATV AL+H + G +E L+ Sbjct: 247 HEAVYAFQYQGKRYDCGSKEGFLEATVELALQHPQVGAHFREYLK 291 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 295 Length adjustment: 26 Effective length of query: 271 Effective length of database: 269 Effective search space: 72899 Effective search space used: 72899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_3541 (UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.5316.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-113 362.5 0.0 8.2e-113 362.3 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 UTP--glucose-1-phosphate uridyly Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 362.3 0.0 8.2e-113 8.2e-113 1 261 [] 7 271 .. 7 271 .. 0.98 Alignments for each domain: == domain 1 score: 362.3 bits; conditional E-value: 8.2e-113 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraie 62 +rkav+P+aGlGtr+LPatka Pkemlp+vdkPliqy+veea +aGi ++++vtgrskraie lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 7 VRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRSKRAIE 68 79************************************************************ PP TIGR01099 63 dhfDtsyeleaklekknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepf 123 dhfDt+yelea+le +nk+ell vr+i++ +++ +vrq + GLGhavl+ae+lvg+epf lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 69 DHFDTAYELEAELEAANKKELLALVRSIQPDdMDCAFVRQPRSLGLGHAVLCAEPLVGKEPF 130 *****************************988****************************** PP TIGR01099 124 avllgDdlvseeee...alkqlielyektgasiiaveevpkeevskYGvidgeeveeelyev 182 avll+Ddl++ +l+q+ +++++ g s+iav+evp+++v+kYG+++ge l+++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 131 AVLLADDLMVGPPGgqpVLAQMASAFRQQGRSVIAVQEVPEDQVHKYGIVAGEPAGGPLIRI 192 *********98654555********************************************* PP TIGR01099 183 kdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkggeiqltDalrlllekeevlavk 244 + +vekPk++ aps + + GrY+ltp +f+ ++++++G+ggeiqltD+++ l+++e+v+a++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 193 ERIVEKPKADVAPSRMGVAGRYILTPGVFDEIRNQPRGVGGEIQLTDGIARLMQHEAVYAFQ 254 ************************************************************** PP TIGR01099 245 lkgkryDvGdklgylka 261 +gkryD+G+k+g+l+a lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3541 255 YQGKRYDCGSKEGFLEA 271 ***************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.57 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory