Align L-lactate dehydrogenase (cytochrome) (EC 1.1.2.3) (characterized)
to candidate Ac3H11_1767 L-lactate dehydrogenase (EC 1.1.2.3)
Query= reanno::Smeli:SM_b20850 (378 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1767 Length = 419 Score = 235 bits (599), Expect = 2e-66 Identities = 140/378 (37%), Positives = 205/378 (54%), Gaps = 10/378 (2%) Query: 1 MTQILEIRDLKALARRRVPKLFFDYADSGAWTEGTYRANEEDFAGIKLRQRVLVDMSDRS 60 + ++L + D + ARRR+P+ F Y A + R N E F RVL D+S RS Sbjct: 37 LRRMLSLHDFEDAARRRLPRPIFGYIAGAAEDNASLRDNREVFGEYAFTTRVLRDVSQRS 96 Query: 61 LETTMIGQKVSMPVALAPTGLTGMQHADGEMLAAQAAEAFGVPFTLSTMSICSIEDVASV 120 + G++ S P +AP G+ + G+++ A AA+ G+ +S S+ +E+VA Sbjct: 97 QAVELFGERYSSPFGIAPMGINALSTYRGDLVLACAAQRAGIVSVMSGTSLIPMEEVARE 156 Query: 121 TTKPFWFQLYVMREREFVLDLIDRAKAAKCSALVMTLDLQILGQRHKDLRNGLSAPPRLT 180 + WFQ Y+ ++ + LIDR + A LV+T+D+ I R ++R G S P R Sbjct: 157 SPGT-WFQAYLPGDQARIDALIDRVERAGFRTLVVTVDIPISANRENNIRTGFSTPLRPG 215 Query: 181 PKHLWMMATRPGWCMKMLGTNRRTF-RNIVGH-----AKSVADLSSLQAWTNEQFDPQLS 234 + W RP W + GT RT R+ + H A A + S + LS Sbjct: 216 LRLAWDGLVRPRW---VAGTFVRTLLRHGMPHFENSFATRGAPIVSSSVLRDFSARDHLS 272 Query: 235 WKDVEWIKERWGGPLILKGILDPEDAKMAAKTGADAIIVSNHGGRQLDGAHSSISMLPRI 294 W +E I+ RW GPL++KG+L EDA A GAD +++SNHGGRQLDGA S++ +L + Sbjct: 273 WNHLEAIRRRWKGPLVVKGVLRVEDALQARNLGADGVVLSNHGGRQLDGAVSAMRVLEAV 332 Query: 295 VEAVGDQIEVHLDGGIRSGQDVLKAIALGAKGTYIGRPFLYGLGALGKEGVTLALDIIRK 354 V AVG V +DGG R G DVLKAIALGA+ +GRPF Y G+ GV A+ ++R Sbjct: 333 VAAVGPAFPVLIDGGFRRGSDVLKAIALGARMVLVGRPFNYAAAVAGEAGVQHAIGLLRD 392 Query: 355 EMDTTMALCGKRRITEVG 372 E+D +A+ G R T++G Sbjct: 393 EVDRNLAMLGARACTDLG 410 Lambda K H 0.321 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 419 Length adjustment: 31 Effective length of query: 347 Effective length of database: 388 Effective search space: 134636 Effective search space used: 134636 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory