Align Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 (characterized)
to candidate Ac3H11_1927 Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)
Query= SwissProt::Q5LUF3 (681 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1927 Length = 670 Score = 417 bits (1071), Expect = e-120 Identities = 234/486 (48%), Positives = 316/486 (65%), Gaps = 17/486 (3%) Query: 4 KILIANRGEIACRVIKTARKMGISTVAIYSDADKQALHVQMADEAVHIGPPPANQSYIVI 63 KILIANR EIA R+I TA +MGI TVA+YSD D ALHV+ A +AV +G + +Y+ Sbjct: 3 KILIANRSEIARRIIHTAHRMGIETVAVYSDPDASALHVREATQAVALGGAASADTYLRT 62 Query: 64 DKVMAAIRATGAQAVHPGYGFLSENSKFAEALEAEGVIFVGPPKGAIEAMGDKITSKKIA 123 DK++AA RATGA AVHPGYGFLSEN+ FA+A+ G+ ++GPP AI A+G K +K +A Sbjct: 63 DKLLAAARATGADAVHPGYGFLSENADFAQAVVDAGLTWIGPPPAAIRALGSKAGAKALA 122 Query: 124 QEANVSTVPGYMGLIEDADEAVKISNQIGYPVMIKASAGGGGKGMRIAWNDQEAREGFQS 183 V +PGY G + + + +IG P+M+KA AGGGG+GMR+ + + S Sbjct: 123 VAHCVPCLPGYAGDDQSDERFAAEAARIGTPLMVKAVAGGGGRGMRLVTDLAQLPAALAS 182 Query: 184 SKNEAANSFGDDRIFIEKFVTQPRHIEIQVLCDSHGNGIYLGERECSIQRRNQKVVEEAP 243 +++EA FG + IE+ + QPRH+E+Q+ D+HG I+LGER+CS+QRR+QK++EEAP Sbjct: 183 ARSEALAGFGCGDLLIERALLQPRHVEVQIFADAHGACIHLGERDCSVQRRHQKIIEEAP 242 Query: 244 SPFLDEATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTRLQVEHPVTELI 303 SP +D A R MG AVALA+A GY AGTVEF++DG +FY +EMNTRLQVEHPVTE + Sbjct: 243 SPAVDAALRERMGACAVALAQAAGYVGAGTVEFLLDG-PDFYLMEMNTRLQVEHPVTEAL 301 Query: 304 TGVDLVEQMIRVAAGEPLSITQGDVKLTGWAIENRLYAEDPYRGFLPSIGRLTRYRPPAE 363 TG+DLVE IRVA GEPL +TQ V L G AIE RL AED + F P GR+ ++ P Sbjct: 302 TGLDLVEWQIRVARGEPLPLTQDQVHLQGHAIEVRLCAEDAH--FRPHTGRVLQFSAPPA 359 Query: 364 TAAGPLLVNGKWQGDAPSGEAAVRNDTGVYEGGEISMYYDPMIAKLCTWAPTRAAAIEAM 423 TA ++ AP A+R D + EG E++ +YD M+ KL APTRA AI A+ Sbjct: 360 TA---------FERAAP---GALRFDHALEEGAEVTPHYDAMLGKLIVHAPTRAEAIAAL 407 Query: 424 RIALDSFEVEGIGHNLPFLSAVMDHPKFISGDMTTAFIAEEYPEGFEGVNLPETDLRRVA 483 AL S V G+ N FL+A + HP F +G F+AE + +G+ L +L+ + Sbjct: 408 VRALHSTRVLGLPTNRAFLAACLQHPVFGAGHALVPFLAEHAAQ-LQGL-LSNIELKVLV 465 Query: 484 AAAAAM 489 +A A+ Sbjct: 466 QSAVAV 471 Score = 37.7 bits (86), Expect = 2e-06 Identities = 19/66 (28%), Positives = 33/66 (50%) Query: 615 LLCPMPGLIVKVDVEVGQEVQEGQALCTIEAMKMENILRAEKKGVVAKINASAGNSLAVD 674 L P G +V + V GQ + G + IE+MK+E+ L + VA++ + G ++ Sbjct: 596 LRAPFNGKVVALPVAAGQALSAGDTVVVIESMKLEHSLASPVAATVAELLVAPGQQVSPG 655 Query: 675 DVIMEF 680 V+ F Sbjct: 656 QVLARF 661 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1085 Number of extensions: 41 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 681 Length of database: 670 Length adjustment: 39 Effective length of query: 642 Effective length of database: 631 Effective search space: 405102 Effective search space used: 405102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory