Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate Ac3H11_3533 Glutaryl-CoA dehydrogenase (EC 1.3.99.7)
Query= BRENDA::Q96329 (436 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3533 Length = 398 Score = 248 bits (634), Expect = 2e-70 Identities = 145/391 (37%), Positives = 220/391 (56%), Gaps = 13/391 (3%) Query: 47 DYYHFNDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSI- 105 D + N LT +E+AIR + ++AP + + + + I ++G +G+ G +I Sbjct: 10 DPFLLNQQLTDDERAIRDAAAAYCQDKLAPRVLDAFRHEKMDVSIFREMGEVGLLGPTIP 69 Query: 106 KGYGCPGLSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQ 165 + YG PGLS A + E+ RVD+ + V SSL M+ I G+EAQK+KYLP LA Sbjct: 70 EQYGGPGLSYVAYGLIAREVERVDSGYRSMASVQSSLVMVPINEFGTEAQKQKYLPKLAT 129 Query: 166 LNTVACWALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTT-- 223 + C+ LTEPD+GSD + T A KV+GG+K+ G K WI NS AD+ +++A+ + Sbjct: 130 GEWIGCFGLTEPDHGSDPGSMATRAYKVDGGYKLKGSKMWITNSPVADVFVVWAKEVSEG 189 Query: 224 --TNQINGFIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSFQDTS 281 I GF+++K GL A I K+GLR G+I++ +VFVP+E+ P V + Sbjct: 190 GAVGPIRGFVLEKGMKGLTAPAIHGKVGLRASITGEIVMDDVFVPEENAFPEVQGLKGPF 249 Query: 282 KVLAVSRVMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMF 341 L +R +AW +G + + +Y +RKQFG PLAA QL Q+KL M Q Sbjct: 250 TCLNSARYGIAWGALGAAEFCWHTARQYTLDRKQFGRPLAANQLIQKKLADM----QTEI 305 Query: 342 LMGWRLC----KLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKA 397 +G + C ++ + G + S+ K KA + A L R+++GGNGI +F VA+ Sbjct: 306 AIGLQACLQFGRMKDAGTASVEGTSIIKRNSCGKALDIARLARDMMGGNGISDEFGVARH 365 Query: 398 FCDLEPIYTYEGTYDINTLVTGREVTGIASF 428 +LE + TYEGT+D++ L+ GR TGIA+F Sbjct: 366 LVNLEVVNTYEGTHDVHALILGRAQTGIAAF 396 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 398 Length adjustment: 31 Effective length of query: 405 Effective length of database: 367 Effective search space: 148635 Effective search space used: 148635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory