Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate Ac3H11_4836 Threonine dehydratase (EC 4.3.1.19)
Query= BRENDA::Q74FW6 (402 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4836 Length = 399 Score = 294 bits (752), Expect = 4e-84 Identities = 170/396 (42%), Positives = 242/396 (61%), Gaps = 4/396 (1%) Query: 1 MLPYTLIQEADDRLRKRVRRTELIHSHHFSEKLGIPIYFKCENLQRTGAFKIRGALNFMT 60 ML I++A RL+ +V T + S S+ +G ++ K ENLQ T +FK RGA N +T Sbjct: 1 MLTLQDIRDAATRLQGQVLDTPCVESKTLSQIVGAQVFLKFENLQFTASFKERGACNRLT 60 Query: 61 SQPREALAKGVITASAGNHAQGVAFSADLLGVPSTVFMPESTPPQKVFATRDYGAEVVLT 120 + A+GV+ SAGNHAQGVA+ A LG+ + + MP TP KV TR +GAEVVL Sbjct: 61 LLSEDERARGVVAMSAGNHAQGVAYHAQRLGLRAVIVMPRFTPAVKVERTRGFGAEVVLH 120 Query: 121 GRNFDEAYAAAVQAQEERGALFVHPFDDPLVMAGQGTIGLEVLQELPDVANILVPIGGGG 180 G +EA A + + FVHP+DD V AGQGT+GLE+LQ +PD+ +++ +GGGG Sbjct: 121 GDTLEEARQHAYALADAQRLTFVHPYDDEGVAAGQGTLGLEMLQAVPDLDTLVIAVGGGG 180 Query: 181 LIAGIATAIRETHPHVRIIGVETAAAPSAHYSLQKGKIVQVPVTVTLADGIAVKKPGVNT 240 LI+G+ATA + P + ++GV+T P+ +++ Q T T+A+GIAV PG T Sbjct: 181 LISGVATAAKAIKPGIEVVGVQTTRFPAMVNAVKGTHHPQ--GTSTIAEGIAVGTPGKIT 238 Query: 241 FPIIRDLVDEVVLVEEEEIALAIVALLERTKLLVEGAGAVPLAALLNRRVTDLSGKTV-C 299 I++ LVD++VLV+E +I A++ LLE K LVEGAGA LAAL+ R GK V Sbjct: 239 QEIVKRLVDDLVLVDEGDIEQAVLMLLEIEKTLVEGAGAAGLAALV-RYPERFQGKRVGL 297 Query: 300 VLSGGNIDVKTISVVVERGLVAAGRYLKLKVELDDLPGALARLATEIAEAKANISIITHD 359 VL GGNID ++ ++ERG+V +GR ++KV D+PG LAR+ +A+A ANI + H Sbjct: 298 VLCGGNIDPLLLAAIIERGMVRSGRLARIKVSARDVPGVLARITATVADAGANIGEVHHQ 357 Query: 360 RRSKSLPIGKTEVLIELETRGFEHIQEVISHLQGVG 395 R L E+ + L+TR H+ EV+ L+ G Sbjct: 358 RAFTLLAAQNVEIELVLQTRSKAHVAEVLEQLRTAG 393 Lambda K H 0.319 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 399 Length adjustment: 31 Effective length of query: 371 Effective length of database: 368 Effective search space: 136528 Effective search space used: 136528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Ac3H11_4836 (Threonine dehydratase (EC 4.3.1.19))
to HMM TIGR01127 (ilvA: threonine ammonia-lyase (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01127.hmm # target sequence database: /tmp/gapView.5186.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01127 [M=380] Accession: TIGR01127 Description: ilvA_1Cterm: threonine ammonia-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-134 434.5 5.3 2e-134 434.3 5.3 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 Threonine dehydratase (EC 4.3.1. Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 Threonine dehydratase (EC 4.3.1.19) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 434.3 5.3 2e-134 2e-134 1 377 [. 21 395 .. 21 398 .. 0.98 Alignments for each domain: == domain 1 score: 434.3 bits; conditional E-value: 2e-134 TIGR01127 1 tpleksstlsditgaevylklenlqktGsfkirGalnkiaklseeekkrGvvaasaGnhaqG 62 tp s+tls+i+ga+v+lk enlq t sfk rGa n+++ lse+e+ rGvva saGnhaqG lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 21 TPCVESKTLSQIVGAQVFLKFENLQFTASFKERGACNRLTLLSEDERARGVVAMSAGNHAQG 82 78999********************************************************* PP TIGR01127 63 valaakvfgikakivmPesaplskvkatksyGaeviLhGadfDeayklaeelaeeegrvfvh 124 va+ a++ g++a+ivmP+++p kv+ t+++Gaev+LhG++++ea ++a la+++ ++fvh lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 83 VAYHAQRLGLRAVIVMPRFTPAVKVERTRGFGAEVVLHGDTLEEARQHAYALADAQRLTFVH 144 ************************************************************** PP TIGR01127 125 afdDefviaGqGtlgleiledlpdvdtvivPvGGGGLisGvasavkklnpevkviGveaeaa 186 ++dDe v aGqGtlgle+l+ +pd+dt+++ vGGGGLisGva+a+k ++p++ v+Gv++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 145 PYDDEGVAAGQGTLGLEMLQAVPDLDTLVIAVGGGGLISGVATAAKAIKPGIEVVGVQTTRF 206 ************************************************************** PP TIGR01127 187 pslveslkegkikavesvktiaDGiavkkpgdltfeivkelvDevvavdeeeiakaillLle 248 p++v+++k ++ + ++tia+Giav +pg++t eivk lvD++v vde +i +a+l+Lle lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 207 PAMVNAVKGT--HHPQGTSTIAEGIAVGTPGKITQEIVKRLVDDLVLVDEGDIEQAVLMLLE 266 *****99765..4567899******************************************* PP TIGR01127 249 rakivaegaGavgvaavleekvdvkgkkvavvvsGGnidlnllekiiekgLvksgrkvkiet 310 +k+++egaGa+g+aa++ +gk+v++v++GGnid+ ll iie+g+v+sgr+++i++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 267 IEKTLVEGAGAAGLAALVRYPERFQGKRVGLVLCGGNIDPLLLAAIIERGMVRSGRLARIKV 328 *******************8888*************************************** PP TIGR01127 311 vlkDkPGaLkklleviaekranivkiehdrlskeialgaakvelelevkgkehleellktlr 372 D PG L ++++++a+++ani +++h+r + +a ++el l+++ k h+ e+l++lr lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 329 SARDVPGVLARITATVADAGANIGEVHHQRAFTLLAAQNVEIELVLQTRSKAHVAEVLEQLR 390 ************************************************************** PP TIGR01127 373 dkgye 377 g e lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4836 391 TAGME 395 99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (380 nodes) Target sequences: 1 (399 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.55 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory