GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Acidovorax sp. GW101-3H11

Align Acetate/butyrate--CoA ligase AAE7, peroxisomal; AMP-binding protein 7; AtAMPBP7; Acetyl-CoA synthetase; Acyl-activating enzyme 7; Butyryl-CoA synthetase; Protein ACETATE NON-UTILIZING 1; EC 6.2.1.1; EC 6.2.1.2 (characterized)
to candidate Ac3H11_191 3-methylmercaptopropionyl-CoA ligase (DmdB)

Query= SwissProt::Q8VZF1
         (569 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_191
           3-methylmercaptopropionyl-CoA ligase (DmdB)
          Length = 548

 Score =  584 bits (1505), Expect = e-171
 Identities = 288/547 (52%), Positives = 379/547 (69%), Gaps = 15/547 (2%)

Query: 12  LPKIPANYTALTPLWFLDRAAVVHPTRKSVIHGSREYTWRQTYDRCRRLASALADRSIGP 71
           LP+  AN+  L+PL F++R A V+P R +++HG+   TW QTY RCR+LASAL    IG 
Sbjct: 9   LPRTEANFAPLSPLSFIERTAEVYPDRLAIVHGTLRQTWAQTYARCRQLASALVQAGIGK 68

Query: 72  GSTVAIIAPNIPAMYEAHFGVPMCGAVLNCVNIRLNAPTVAFLLSHSQSSVIMVDQEFFT 131
             TVA++ PN P M EAHFGVPM GAVLN +N RL+   +AF+L H ++ V++VD EF  
Sbjct: 69  NDTVAVMLPNTPPMVEAHFGVPMAGAVLNALNTRLDPEAIAFMLDHGEAKVVLVDPEFTG 128

Query: 132 LAEDSLRLMEEKAGSSFKRPLLIVIGDHTCAPESLNRALSKGAIEYEDFLATGDPNYPWQ 191
               +L L   + G++  R + +    +  A + L      G  +Y+ F+A+GD  + W+
Sbjct: 129 TMAKALAL---RTGTTPIRVIEVQDALYGPAVQGL------GGTDYDAFVASGDATFAWR 179

Query: 192 PPADEWQSIALGYTSGTTASPKGVVLHHRGAYIMALSNPLIWGMQDGAVYLWTLPMFHCN 251
            PADEW +IAL YTSGTT +PKGVV HHRGA   A+SN L W M   AVYLWTLPMFHCN
Sbjct: 180 LPADEWDAIALNYTSGTTGNPKGVVYHHRGAASNAISNVLEWDMPKHAVYLWTLPMFHCN 239

Query: 252 GWCFPWSLAVLSGTSICLRQVTAKEVYSMIAKYKVTHFCAAPVVLNAIVNAPKEDTILPL 311
           GWCFPW++A  +G ++CLR+V A+ ++  I  + VTH+C AP+V   +VNAP E     +
Sbjct: 240 GWCFPWTIAARAGVNVCLRRVDAQAIFDAIRTHGVTHYCGAPIVHGLLVNAP-EAMKAGI 298

Query: 312 PHTVHVMTAGAAPPPSVLFSMNQKGFRVAHTYGLSETYGPSTVCAWKPEWDSLPPETQAK 371
           P  V  M AGAAPP S++  M + GF + H YGL+E YGP+TVCA    WD L    +A+
Sbjct: 299 PAGVKAMVAGAAPPASMIEGMEKMGFDLTHVYGLTEVYGPATVCAKHEAWDQLDIGERAR 358

Query: 372 LNARQGVRYTGMEQLDVIDTQTGKPVPADGKTAGEIVFRGNMVMKGYLKNPEANKETFAG 431
           LNARQGVRY     + V+D +T +PVP DG+T GEI+F+GN+ MKGYLKNP+A +E FAG
Sbjct: 359 LNARQGVRYHLERDVRVLDPETMQPVPQDGETMGEIMFKGNIAMKGYLKNPKATEEAFAG 418

Query: 432 GWFHSGDIAVKHPDNYIEIKDRSKDVIISGGENISSVEVENVVYHHPAVLEASVVARPDE 491
           GWFHSGD+AV++PD YI+IKDRSKD+IISGGENISS+EVE+V+Y HP VL A+VVA+PD 
Sbjct: 419 GWFHSGDLAVQYPDGYIKIKDRSKDIIISGGENISSIEVEDVLYRHPDVLAAAVVAKPDA 478

Query: 492 RWQESPCAFVTLKSDYEKHDQNKLAQDIMKFCREKLPAYWVPKSVVFGPLPKTATGKIQK 551
           +W E+PCAFV LK+  E        +DI+  C++ L  + VP++VVFG LPKT+TGKIQK
Sbjct: 479 KWGETPCAFVELKAGAE-----ATPEDIVAHCKKHLAGFKVPRAVVFGELPKTSTGKIQK 533

Query: 552 HILRTKA 558
             LR  A
Sbjct: 534 FELRKLA 540


Lambda     K      H
   0.319    0.134    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 916
Number of extensions: 34
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 569
Length of database: 548
Length adjustment: 36
Effective length of query: 533
Effective length of database: 512
Effective search space:   272896
Effective search space used:   272896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory