GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Acidovorax sp. GW101-3H11

Align Acyl-CoA synthetase short-chain family member 3, mitochondrial; Acetate--CoA ligase 3; Acyl-CoA synthetase short-chain family member 3; Propionate--CoA ligase; EC 6.2.1.1; EC 6.2.1.17 (characterized)
to candidate Ac3H11_2208 Propionate--CoA ligase (EC 6.2.1.17)

Query= SwissProt::Q9H6R3
         (686 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2208 Propionate--CoA
           ligase (EC 6.2.1.17)
          Length = 633

 Score =  501 bits (1290), Expect = e-146
 Identities = 271/635 (42%), Positives = 388/635 (61%), Gaps = 18/635 (2%)

Query: 60  SEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDR 119
           S Y   +  S+   + FW + A+ I W  P  +  +  + P  +WFV G  N+C+NAVDR
Sbjct: 5   STYADFYRQSIDHRDAFWSEQAQLIDWKTPPQQVCDYSNPPFAKWFVGGTTNLCHNAVDR 64

Query: 120 HIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIP 179
           H+   +  + A++  S  T+T+ ++++ E+  +V ++A VL   G+KKGD V+IYMPMI 
Sbjct: 65  HLAT-RASQAALVAISTETDTERSYSFAELHAEVQRMAAVLQSLGVKKGDRVLIYMPMIA 123

Query: 180 QAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVE 239
           +A + MLAC RIGA+HS++FGGFAS  L+SRI+  +P  VV+A  G   G+ V Y PL++
Sbjct: 124 EAAFAMLACVRIGALHSVVFGGFASGSLASRIEDSEPVAVVSADAGSRGGKVVPYKPLLD 183

Query: 240 EALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVP---VLSEHPLYI 296
           EA+ + +HKP  +L+ NR  +  + L PGRD  W   + +   +  VP   V S HP Y 
Sbjct: 184 EAIALSKHKPAAVLMVNR-GLAPMHLQPGRDHAW-ASLREQHLNTVVPCEWVDSTHPSYT 241

Query: 297 LYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPL 356
           LYTSGTTG PKGV R TGGYAV L  SM  I+  QPGEV++A SD+GWVVGHSYI YGPL
Sbjct: 242 LYTSGTTGKPKGVQRDTGGYAVALAASMKHIFDAQPGEVYFATSDIGWVVGHSYIIYGPL 301

Query: 357 LHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLT 416
           L G TT++YEG P+  PDAG ++ ++ ++ V  +F+APTA+R +++QDP  A   QY++ 
Sbjct: 302 LAGMTTIMYEGLPI-RPDAGVWWSIVEKYQVTHMFSAPTAVRVLKKQDP--AFLTQYNVK 358

Query: 417 RFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAG 476
             K L++AGE  D  T  W      +P++D++WQTETG PI A   G+  +     G  G
Sbjct: 359 SLKALWLAGEPVDEPTARWIGAALNIPIIDNYWQTETGWPILAVANGI-EANAARWGSPG 417

Query: 477 KSVPGYNVMILDD--NMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPG- 533
           K+V GY+V +LD+    +   A   G + ++ PLPPG    +W++   F + Y++  PG 
Sbjct: 418 KAVYGYHVKLLDEATGEELTGANQKGVVAIEGPLPPGCMQTVWRDDARFVNTYWKSIPGR 477

Query: 534 -YYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDP 592
             Y T D G  D +GY +++ R DDVINVAGHR+    IEESI SH  +A+ AVVG  D 
Sbjct: 478 LIYSTFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESIASHPNIAEVAVVGVADS 537

Query: 593 LKGHVPLALCVLRK----DINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSG 648
           LKG V +A  V R     D +A   ++  E++K V   +G VA      FV  LPKTRSG
Sbjct: 538 LKGQVAMAFAVARDASGLDSDAARLKLEGEVMKQVDSQLGAVARPSRVYFVSVLPKTRSG 597

Query: 649 KIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEML 683
           K+ R AL A+   +     +T+EDP+    V+E++
Sbjct: 598 KLLRRALQAVAERRDPGDLTTMEDPAALQQVKELV 632


Lambda     K      H
   0.318    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1081
Number of extensions: 52
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 686
Length of database: 633
Length adjustment: 38
Effective length of query: 648
Effective length of database: 595
Effective search space:   385560
Effective search space used:   385560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory