Align MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized)
to candidate Ac3H11_2880 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)
Query= TCDB::P23200 (336 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2880 Length = 350 Score = 134 bits (338), Expect = 3e-36 Identities = 96/308 (31%), Positives = 161/308 (52%), Gaps = 16/308 (5%) Query: 20 VVLLVLLAII-IFQDPTFLSLLNLSNILTQSSVRIIIALGVAGLIVTQGTDLSAGRQVGL 78 V+ LVLL I + F + N+ N+LT+++ IIA+G+ +I++ G DLS G + Sbjct: 44 VIGLVLLCIAGTLLNSNFATYDNVMNVLTRTAFIGIIAVGMCFVIISGGIDLSVG---SM 100 Query: 79 AAVVAATLLQSMDNANKVFPEMATMPIALVI--LIVCAIGAVIGLINGLIIAYLNVTPFI 136 AA++A +++ M N + P + + A+V+ L+ +GAV GL++GL+I + PFI Sbjct: 101 AALIAGSVILFM---NAMAPVLGSPMAAVVVGMLLAVVLGAVFGLVHGLLITKGRIEPFI 157 Query: 137 TTLGTMIIVYGINSLYYDFVGASPISGFDSGFSTFAQGFVALGSFRLSYITFYALIAVAF 196 TLGT+ GI Y + ++ S + + L+ Sbjct: 158 VTLGTL----GIFRAYLTYFSNGGAITLENDLSDIYSPVYYANLLGVPIPVWIFLLVAIV 213 Query: 197 VWVLWNKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYALSGVFYAFGGMLEAGRIGSA 256 V+ N+T +G+ + AIG N + A+ + V+V ++ Y L GV +L R+GSA Sbjct: 214 GGVILNRTAYGRYVQAIGSNEQVAQYAAVDVHKIKILTYMLLGVCVGIATLLYVPRLGSA 273 Query: 257 TNNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFTVIN--YGLTYIGVNPYWQY 314 + G ++EL+AIAA +VGG GG G++ G V G I+ +VI+ LT I ++ Y Sbjct: 274 SPTTGLLWELEAIAAVIVGGTVLKGGAGSITGTVVGAILLSVISNILNLTSI-ISVYLNA 332 Query: 315 IIKGAIII 322 ++G +II Sbjct: 333 AVQGFVII 340 Lambda K H 0.327 0.143 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 350 Length adjustment: 29 Effective length of query: 307 Effective length of database: 321 Effective search space: 98547 Effective search space used: 98547 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory